Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Galectin-13 Recombinant Protein | LGALS13 recombinant protein

Recombinant Human Galectin-13

Average rating 0.0
No ratings yet
Gene Names
LGALS13; PP13; GAL13; PLAC8
Purity
Greater than 90.0% as determined by SDS-PAGE.
Synonyms
Galectin-13; N/A; Recombinant Human Galectin-13; Galactoside-binding soluble lectin 13, Galectin-13, Gal-13, Placental tissue protein 13, PP13, Placental protein 13, LGALS13, PLAC8, GAL13.; LGALS13 recombinant protein
Ordering
Host
Escherichia Coli.
Purity/Purification
Greater than 90.0% as determined by SDS-PAGE.
Form/Format
LGALS13 protein solution (0.5mg/ml) is formulated in 1xPBS buffer pH 7.4
Sequence
MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDM DEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGK QFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN
Sequence Length
139
Physical Appearance
Sterile filtered colorless solution
Preparation and Storage
Store at 4°C if entire vial will be used within 2-4 weeks.
Store, frozen at -20°C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Related Product Information for LGALS13 recombinant protein
Description: Recombinant Human LGALS13 produced in E Coli is a single, non-glycosylated polypeptide chain having a molecular mass of 16kDa. The LGALS13 also might appear as a homodimer, having a total Mw of 32kDa. LGALS13 was purified using standard chromatography techniques.
Product Categories/Family for LGALS13 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
galactoside-binding soluble lectin 13
NCBI Official Synonym Full Names
lectin, galactoside-binding, soluble, 13
NCBI Official Symbol
LGALS13
NCBI Official Synonym Symbols
PP13; GAL13; PLAC8
NCBI Protein Information
galactoside-binding soluble lectin 13; beta-galactoside-binding lectin; gal-13; galectin 13; galectin-13; placental protein 13; placental tissue protein 13
UniProt Protein Name
Galactoside-binding soluble lectin 13
UniProt Gene Name
LGALS13
UniProt Synonym Gene Names
PLAC8; Gal-13; PP13; Placental protein 13
UniProt Entry Name
PP13_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The LGALS13 lgals13 (Catalog #AAA38855) is a Recombinant Protein produced from Escherichia Coli. and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MSSLPVPYKL PVSLSVGSCV IIKGTPIHSF INDPQLQVDF YTDM DEDSDIAFRF RVHFGNHVVM NRREFGIWML EETTDYVPFE DGK QFELCIYVHY NEYEIKVNGI RIYGFVHRIP PSFVKMVQVS RDISLTSVCV CN. It is sometimes possible for the material contained within the vial of "Galectin-13, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.