Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA114668_SDS_PAGE15.jpg SDS-PAGE

Lipopolysaccharide export system protein LptA Recombinant Protein | lptA recombinant protein

Recombinant Escherichia coli Lipopolysaccharide export system protein LptA

Gene Names
lptA; ECK3189; JW3167; yhbN
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lipopolysaccharide export system protein LptA; N/A; Recombinant Escherichia coli Lipopolysaccharide export system protein LptA; lptA recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
28-185. Full Length of Mature Protein
Sequence
VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA114668_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for lptA recombinant protein
Involved in the assembly of lipopolysaccharide (LPS). Required for the translocation of LPS from the inner membrane to the outer membrane. May form a bridge between the inner membrane and the outer membrane, via interactions with LptC and LptD, thereby facilitating LPS transfer across the periplasm.
References
Novel proteins of the phosphotransferase system encoded within the rpoN operon of Escherichia coli. Enzyme IIANtr affects growth on organic nitrogen and the conditional lethality of an erats mutant.Powell B.S., Court D.L., Inada T., Nakamura Y., Michotey V., Cui X., Reizer A., Saier M.H. Jr., Reizer J.J. Biol. Chem. 270:4822-4839(1995) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12.Link A.J., Robison K., Church G.M.Electrophoresis 18:1259-1313(1997) Non-essential KDO biosynthesis and new essential cell envelope biogenesis genes in the Escherichia coli yrbG-yhbG locus.Sperandeo P., Pozzi C., Deho G., Polissi A.Res. Microbiol. 157:547-558(2006) Characterization of lptA and lptB, two essential genes implicated in lipopolysaccharide transport to the outer membrane of Escherichia coli.Sperandeo P., Cescutti R., Villa R., Di Benedetto C., Candia D., Deho G., Polissi A.J. Bacteriol. 189:244-253(2007) Functional analysis of the protein machinery required for transport of lipopolysaccharide to the outer membrane of Escherichia coli.Sperandeo P., Lau F.K., Carpentieri A., De Castro C., Molinaro A., Deho G., Silhavy T.J., Polissi A.J. Bacteriol. 190:4460-4469(2008) The LptA protein of Escherichia coli is a periplasmic lipid A-binding protein involved in the lipopolysaccharide export pathway.Tran A.X., Trent M.S., Whitfield C.J. Biol. Chem. 283:20342-20349(2008) Proteins required for lipopolysaccharide assembly in Escherichia coli form a transenvelope complex.Chng S.S., Gronenberg L.S., Kahne D.Biochemistry 49:4565-4567(2010) Characterization of interactions between LPS transport proteins of the Lpt system.Bowyer A., Baardsnes J., Ajamian E., Zhang L., Cygler M.Biochem. Biophys. Res. Commun. 404:1093-1098(2011) New insights into the Lpt machinery for lipopolysaccharide transport to the cell surface LptA-LptC interaction and LptA stability as sensors of a properly assembled transenvelope complex.Sperandeo P., Villa R., Martorana A.M., Samalikova M., Grandori R., Deho G., Polissi A.J. Bacteriol. 193:1042-1053(2011) Regulated assembly of the transenvelope protein complex required for lipopolysaccharide export.Freinkman E., Okuda S., Ruiz N., Kahne D.Biochemistry 51:4800-4806(2012) Novel structure of the conserved Gram-negative lipopolysaccharide transport protein A and mutagenesis analysis.Suits M.D.L., Sperandeo P., Deho G., Polissi A., Jia Z.J. Mol. Biol. 380:476-488(2008)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19.3 kDa
NCBI Official Full Name
lipopolysaccharide export ABC transporter periplasmic binding protein; Lipid A binding protein; LPS export and assembly protein
NCBI Official Symbol
lptA
NCBI Official Synonym Symbols
ECK3189; JW3167; yhbN
NCBI Protein Information
lipopolysaccharide export ABC transporter periplasmic binding protein; Lipid A binding protein; LPS export and assembly protein
UniProt Protein Name
Lipopolysaccharide export system protein LptA
UniProt Gene Name
lptA
UniProt Entry Name
LPTA_ECOLI

Similar Products

Product Notes

The lptA lpta (Catalog #AAA114668) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-185. Full Length of Mature Protein. The amino acid sequence is listed below: VTGDTDQPIH IESDQQSLDM QGNVVTFTGN VIVTQGTIKI NADKVVVTRP GGEQGKEVID GYGKPATFYQ MQDNGKPVEG HASQMHYELA KDFVVLTGNA YLQQVDSNIK GDKITYLVKE QKMQAFSDKG KRVTTVLVPS QLQDKNNKGQ TPAQKKGN. It is sometimes possible for the material contained within the vial of "Lipopolysaccharide export system protein LptA, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.