Low-density lipoprotein receptor-related protein 4 Recombinant Protein | LRP4 recombinant protein
Recombinant Human Low-density lipoprotein receptor-related protein 4
Gene Names
LRP4; CLSS; CMS17; LRP-4; LRP10; MEGF7; SOST2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Low-density lipoprotein receptor-related protein 4; N/A; Recombinant Human Low-density lipoprotein receptor-related protein 4; Multiple epidermal growth factor-like domains 7; LRP4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1747-1905aa; Cytoplasmic Domain
Sequence
YRHKKSKFTDPGMGNLTYSNPSYRTSTQEVKIEAIPKPAMYNQLCYKKEGGPDHNYTKEKIKIVEGICLLSGDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQSECSSVHTAATPERRGSLPDTGWKHERKLSSESQV
Sequence Length
1905
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for LRP4 recombinant protein
Mediates SOST-dependent inhibition of bone formation. Functions as a specific facilitator of SOST-mediated inhibition of Wnt signaling. Plays a key role in the formation and the maintenance of the neuromuscular junction (NMJ), the synapse between motor neuron and skeletal muscle. Directly binds AGRIN and recruits it to the MUSK signaling complex. Mediates the AGRIN-induced phosphorylation of MUSK, the kinase of the complex. The activation of MUSK in myotubes induces the formation of NMJ by regulating different processes including the transcription of specific genes and the clustering of AChR in the postsynaptic membrane. Alternatively, may be involved in the negative regulation of the canonical Wnt signaling pathway, being able to antagonize the LRP6-mediated activation of this pathway. More generally, has been proposed to function as a cell surface endocytic receptor binding and internalizing extracellular ligands for degradation by lysosomes.
Product Categories/Family for LRP4 recombinant protein
References
Low density lipoprotein receptor-related protein 10.Ishikawa K., Fujimoto H., Kim D., Saeki S. Identification of high-molecular-weight proteins with multiple EGF-like motifs by motif-trap screening.Nakayama M., Nakajima D., Nagase T., Nomura N., Seki N., Ohara O.Genomics 51:27-34(1998) Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006) LRP4 mutations alter Wnt/beta-catenin signaling and cause limb and kidney malformations in Cenani-Lenz syndrome.Li Y., Pawlik B., Elcioglu N., Aglan M., Kayserili H., Yigit G., Percin F., Goodman F., Nurnberg G., Cenani A., Urquhart J., Chung B.D., Ismail S., Amr K., Aslanger A.D., Becker C., Netzer C., Scambler P., Eyaid W., Hamamy H., Clayton-Smith J., Hennekam R., Nurnberg P., Herz J., Temtamy S.A., Wollnik B.Am. J. Hum. Genet. 86:696-706(2010) Bone overgrowth-associated mutations in the LRP4 gene impair sclerostin facilitator function.Leupin O., Piters E., Halleux C., Hu S., Kramer I., Morvan F., Bouwmeester T., Schirle M., Bueno-Lozano M., Fuentes F.J., Itin P.H., Boudin E., de Freitas F., Jennes K., Brannetti B., Charara N., Ebersbach H., Geisse S., Lu C.X., Bauer A., Van Hul W., Kneissel M.J. Biol. Chem. 286:19489-19500(2011)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19.9 kDa
NCBI Official Full Name
low-density lipoprotein receptor-related protein 4
NCBI Official Synonym Full Names
LDL receptor related protein 4
NCBI Official Symbol
LRP4
NCBI Official Synonym Symbols
CLSS; CMS17; LRP-4; LRP10; MEGF7; SOST2
NCBI Protein Information
low-density lipoprotein receptor-related protein 4
UniProt Protein Name
Low-density lipoprotein receptor-related protein 4
UniProt Gene Name
LRP4
UniProt Synonym Gene Names
KIAA0816; LRP10; MEGF7; LRP-4
UniProt Entry Name
LRP4_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The LRP4 lrp4 (Catalog #AAA114555) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1747-1905aa; Cytoplasmic Domain. The amino acid sequence is listed below: YRHKKSKFTD PGMGNLTYSN PSYRTSTQEV KIEAIPKPAM YNQLCYKKEG GPDHNYTKEK IKIVEGICLL SGDDAEWDDL KQLRSSRGGL LRDHVCMKTD TVSIQASSGS LDDTETEQLL QEEQSECSSV HTAATPERRG SLPDTGWKHE RKLSSESQV. It is sometimes possible for the material contained within the vial of "Low-density lipoprotein receptor-related protein 4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
