Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA114057_SDS_PAGE15.jpg SDS-PAGE

Acyl-protein thioesterase 1 Recombinant Protein | Lypla1 recombinant protein

Recombinant Mouse Acyl-protein thioesterase 1

Average rating 0.0
No ratings yet
Gene Names
Lypla1; Pla1a
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Acyl-protein thioesterase 1; N/A; Recombinant Mouse Acyl-protein thioesterase 1; Lysophospholipase 1; Lysophospholipase I; LPL-I; Lyso; PLA I; Lypla1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-230. Full-Length
Sequence
MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLLPPID
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA114057_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Lypla1 recombinant protein
Hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity toward KCNMA1. Has low lysophospholipase activity.
References
Cloning, expression, and catalytic mechanism of murine lysophospholipase I.Wang A., Deems R.A., Dennis E.A.J. Biol. Chem. 272:12723-12729(1997) Lubec G., Yang J.W., Zigmond M.Submitted (JUL-2007) to UniProtKB Regiospecificity and catalytic triad of lysophospholipase I.Wang A., Loo R., Chen Z., Dennis E.A.J. Biol. Chem. 272:22030-22036(1997) Label-free quantitative proteomics of the lysine acetylome in mitochondria identifies substrates of SIRT3 in metabolic pathways.Rardin M.J., Newman J.C., Held J.M., Cusack M.P., Sorensen D.J., Li B., Schilling B., Mooney S.D., Kahn C.R., Verdin E., Gibson B.W.Proc. Natl. Acad. Sci. U.S.A. 110:6601-6606(2013)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51.7 kDa
NCBI Official Full Name
acyl-protein thioesterase 1
NCBI Official Synonym Full Names
lysophospholipase 1
NCBI Official Symbol
Lypla1
NCBI Official Synonym Symbols
Pla1a
NCBI Protein Information
acyl-protein thioesterase 1
UniProt Protein Name
Acyl-protein thioesterase 1
UniProt Gene Name
Lypla1
UniProt Synonym Gene Names
Apt1; Pla1a; APT-1; LPL-I; LysoPLA I
UniProt Entry Name
LYPA1_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Lypla1 lypla1 (Catalog #AAA114057) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-230. Full-Length. The amino acid sequence is listed below: MCGNNMSAPM PAVVPAARKA TAAVIFLHGL GDTGHGWAEA FAGIKSPHIK YICPHAPVMP VTLNMNMAMP SWFDIVGLSP DSQEDESGIK QAAETVKALI DQEVKNGIPS NRIILGGFSQ GGALSLYTAL TTQQKLAGVT ALSCWLPLRA SFSQGPINSA NRDISVLQCH GDCDPLVPLM FGSLTVERLK ALINPANVTF KIYEGMMHSS CQQEMMDVKH FIDKLLPPID. It is sometimes possible for the material contained within the vial of "Acyl-protein thioesterase 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.