Matrix protein 2 (M2) Recombinant Protein | M2 recombinant protein

Recombinant Influenza A virus Matrix protein 2 (M2)

Cat. Num. AAA26944

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Matrix protein 2 (M2); N/A; Recombinant Influenza A virus Matrix protein 2 (M2); M2 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-97aa; Full Length Protein
• Sequence: MSLLTEVETPIRNEWGCRCNGSSDPLVIAASIIGILHLILWILDRLLFKCIYRRFKYGLKRGPSTEGVPESMREEYRKEQQSAVDADDGHFVNIEPE

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Influenza A virus (strain A/USA:Phila/1935 H1N1)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

Related Product Information for M2 recombinant protein

Forms a proton-selective ion channel that is necessary for the efficient release of the viral genome during virus entry. After attaching to the cell surface, the virion enters the cell by endocytosis. Acidification of the endosome triggers M2 ion channel activity. The influx of protons into virion interior is believed to disrupt interactions between the viral ribonucleoprotein (RNP), matrix protein 1 (M1), and lipid bilayers, thereby freeing the viral genome from interaction with viral proteins and enabling RNA segments to migrate to the host cell nucleus, where influenza virus RNA transcription and replication occur. Also plays a role in viral proteins secretory pathway. Elevates the intravesicular pH of normally acidic compartments, such as trans-Golgi network, preventing newly formed hemagglutinin from premature switching to the fusion-active conformation (By similarity).

Product Categories/Family for M2 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 229890367
• UniProt Accession #: A4GCM0
• Molecular Weight: 15.1 kDa
• NCBI Official Full Name: Matrix protein 2
• UniProt Protein Name: Matrix protein 2
• UniProt Gene Name: M2
• UniProt Entry Name: M2_I35A3