Mucosal addressin cell adhesion molecule 1 Recombinant Protein | Madcam1 recombinant protein
Recombinant Rat Mucosal addressin cell adhesion molecule 1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mucosal addressin cell adhesion molecule 1; N/A; Recombinant Rat Mucosal addressin cell adhesion molecule 1; MAdCAM-1; rMAdCAM-1; Madcam1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-353aa; Extracellular Domain
Sequence
QSFQVNPPEPEVAVAMGTSLQINCSMSCDKDIARVHWHGLDTNLGNVQTLPGSRVLSVRGMLSDTGTRVCVGSCGSRSFQHSVKILVYAFPDQLEVTPEFLVPGRDQVVSCTAHNIWPAGPDSLSFALLRGEQSLEGAQALETEQEEEMQETEGTPLFQVTQRWLLPSLGTPALPALYCQVTMQLPKLVLTHRRKIPVLQSQTSPEPPSTTSAKPYILTSSHTTKAVSTGLSSVALPSTPLSSEGPCYPEIHQNPEADWELLCEASCGSGVTVHWTLAPGDLAAYHKREAGAQAWLSVLPLGPIPEGWFQCRMDPGGQVTSLYVTGQVIPNPSS
Sequence Length
394
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Madcam1 recombinant protein
Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both the integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes
Product Categories/Family for Madcam1 recombinant protein
References
"Cloning and characterization of the rat MAdCAM-1 cDNA and gene." Iizuka T., Koike R., Miyasaka N., Miyasaka M., Watanabe T. Biochim. Biophys. Acta 1395:266-270(1998)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
mucosal addressin cell adhesion molecule 1
NCBI Official Synonym Full Names
mucosal vascular addressin cell adhesion molecule 1
NCBI Official Symbol
Madcam1
NCBI Protein Information
mucosal addressin cell adhesion molecule 1
UniProt Protein Name
Mucosal addressin cell adhesion molecule 1
UniProt Gene Name
Madcam1
UniProt Synonym Gene Names
MAdCAM-1; rMAdCAM-1
UniProt Entry Name
MADCA_RAT
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Madcam1 madcam1 (Catalog #AAA115135) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-353aa; Extracellular Domain. The amino acid sequence is listed below: QSFQVNPPEP EVAVAMGTSL QINCSMSCDK DIARVHWHGL DTNLGNVQTL PGSRVLSVRG MLSDTGTRVC VGSCGSRSFQ HSVKILVYAF PDQLEVTPEF LVPGRDQVVS CTAHNIWPAG PDSLSFALLR GEQSLEGAQA LETEQEEEMQ ETEGTPLFQV TQRWLLPSLG TPALPALYCQ VTMQLPKLVL THRRKIPVLQ SQTSPEPPST TSAKPYILTS SHTTKAVSTG LSSVALPSTP LSSEGPCYPE IHQNPEADWE LLCEASCGSG VTVHWTLAPG DLAAYHKREA GAQAWLSVLP LGPIPEGWFQ CRMDPGGQVT SLYVTGQVIP NPSS. It is sometimes possible for the material contained within the vial of "Mucosal addressin cell adhesion molecule 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
