MADCAM1 / Mucosal Addressin Cell Adhesion Molecule 1 Recombinant Protein | MADCAM1 recombinant protein
Human MADCAM1 / Mucosal Addressin Cell Adhesion Molecule 1 Recombinant Protein
Gene Names
MADCAM1; MACAM1
Applications
Western Blot, ELISA
Purity
>95% by SDS-PAGE
Synonyms
MADCAM1 / Mucosal Addressin Cell Adhesion Molecule 1; N/A; Human MADCAM1 / Mucosal Addressin Cell Adhesion Molecule 1 Recombinant Protein; Mucosal addressin cell adhesion molecule 1; MAdCAM-1; MADCAM1 recombinant protein
Host
E Coli
Purity/Purification
>95% by SDS-PAGE
Form/Format
Liquid; 50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole, 10% Glycerol (PH8.0)
Concentration
Reconstitution Dependent (varies by lot)
Sequence
EEEEPQGDEDVLFRVTERWRLPPLGTPVPPALYCQATMRLPGLELSHRQAIPVLHSPTSPEPPDTTSPESPDTTSPESPDTTSQEPPDTTSPEPPDKTSPEPAPQQGSTHTPRSPGSTRTRRPEISQGPTQGEVIPTGSSKPAGDQ
Applicable Applications for MADCAM1 recombinant protein
WB (Western Blot), ELISA
Species
Human
Tag
His
Subunit
Homodimer.
Entry Function
Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding.
Preparation and Storage
Store at -20 degree C. Avoid repeated freezing and thawing.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16.17KD
NCBI Official Full Name
mucosal addressin cell adhesion molecule 1 isoform a
NCBI Official Synonym Full Names
mucosal vascular addressin cell adhesion molecule 1
NCBI Official Symbol
MADCAM1
NCBI Official Synonym Symbols
MACAM1
NCBI Protein Information
mucosal addressin cell adhesion molecule 1
UniProt Protein Name
Mucosal addressin cell adhesion molecule 1
UniProt Gene Name
MADCAM1
UniProt Synonym Gene Names
MAdCAM-1; hMAdCAM-1
UniProt Entry Name
MADCA_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The MADCAM1 madcam1 (Catalog #AAA196941) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MADCAM1 / Mucosal Addressin Cell Adhesion Molecule 1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA. Researchers should empirically determine the suitability of the MADCAM1 madcam1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EEEEPQGDED VLFRVTERWR LPPLGTPVPP ALYCQATMRL PGLELSHRQA IPVLHSPTSP EPPDTTSPES PDTTSPESPD TTSQEPPDTT SPEPPDKTSP EPAPQQGSTH TPRSPGSTRT RRPEISQGPT QGEVIPTGSS KPAGDQ. It is sometimes possible for the material contained within the vial of "MADCAM1 / Mucosal Addressin Cell Adhesion Molecule 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.