Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Melanoma-associated antigen 8 (MAGEA8) Recombinant Protein | MAGEA8 recombinant protein

Recombinant Human Melanoma-associated antigen 8 (MAGEA8)

Gene Names
MAGEA8; CT1.8; MAGE8
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Melanoma-associated antigen 8 (MAGEA8); N/A; Recombinant Human Melanoma-associated antigen 8 (MAGEA8); MAGEA8 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-318aa; Full Length
Sequence
MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLGMILMEGSRAPEEAIWEALSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQAPGSDPVRYEFLWGPRALAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for MAGEA8 recombinant protein
This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Multiple alternatively spliced variants, encoding the same protein, have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,215 Da
NCBI Official Full Name
melanoma-associated antigen 8
NCBI Official Synonym Full Names
MAGE family member A8
NCBI Official Symbol
MAGEA8
NCBI Official Synonym Symbols
CT1.8; MAGE8
NCBI Protein Information
melanoma-associated antigen 8
UniProt Protein Name
Melanoma-associated antigen 8
UniProt Gene Name
MAGEA8
UniProt Synonym Gene Names
MAGE8; CT1.8

Similar Products

Product Notes

The MAGEA8 magea8 (Catalog #AAA113962) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-318aa; Full Length. The amino acid sequence is listed below: MLLGQKSQRY KAEEGLQAQG EAPGLMDVQI PTAEEQKAAS SSSTLIMGTL EEVTDSGSPS PPQSPEGASS SLTVTDSTLW SQSDEGSSSN EEEGPSTSPD PAHLESLFRE ALDEKVAELV RFLLRKYQIK EPVTKAEMLE SVIKNYKNHF PDIFSKASEC MQVIFGIDVK EVDPAGHSYI LVTCLGLSYD GLLGDDQSTP KTGLLIIVLG MILMEGSRAP EEAIWEALSV MGLYDGREHS VYWKLRKLLT QEWVQENYLE YRQAPGSDPV RYEFLWGPRA LAETSYVKVL EHVVRVNARV RISYPSLHEE ALGEEKGV. It is sometimes possible for the material contained within the vial of "Melanoma-associated antigen 8 (MAGEA8), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.