Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Melanoma-associated antigen B2 (MAGEB2) Recombinant Protein | MAGEB2 recombinant protein

Recombinant Human Melanoma-associated antigen B2 (MAGEB2)

Average rating 0.0
No ratings yet
Gene Names
MAGEB2; DAM6; CT3.2; MAGE-XP-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Melanoma-associated antigen B2 (MAGEB2); N/A; Recombinant Human Melanoma-associated antigen B2 (MAGEB2); MAGEB2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-319. Full Length
Sequence
MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQEPQRAPTTAAAAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKIVGKRFREHFPEILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGVIFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPWKLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAYAETSKMKVLEFLAKVNGTTPCAFPTHYEEALKDEEKAGV
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for MAGEB2 recombinant protein
This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. This gene is localized in the DSS (dosage-sensitive sex reversal) critical region. It is expressed in testis and placenta, and in a significant fraction of tumors of various histological types. The MAGEB genes are clustered on chromosome Xp22-p21.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,277 Da
NCBI Official Full Name
melanoma-associated antigen B2
NCBI Official Synonym Full Names
MAGE family member B2
NCBI Official Symbol
MAGEB2
NCBI Official Synonym Symbols
DAM6; CT3.2; MAGE-XP-2
NCBI Protein Information
melanoma-associated antigen B2
UniProt Protein Name
Melanoma-associated antigen B2
UniProt Gene Name
MAGEB2
UniProt Synonym Gene Names
CT3.2; DAM6

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MAGEB2 mageb2 (Catalog #AAA115380) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-319. Full Length. The amino acid sequence is listed below: MPRGQKSKLR AREKRRKARD ETRGLNVPQV TEAEEEEAPC CSSSVSGGAA SSSPAAGIPQ EPQRAPTTAA AAAAGVSSTK SKKGAKSHQG EKNASSSQAS TSTKSPSEDP LTRKSGSLVQ FLLYKYKIKK SVTKGEMLKI VGKRFREHFP EILKKASEGL SVVFGLELNK VNPNGHTYTF IDKVDLTDEE SLLSSWDFPR RKLLMPLLGV IFLNGNSATE EEIWEFLNML GVYDGEEHSV FGEPWKLITK DLVQEKYLEY KQVPSSDPPR FQFLWGPRAY AETSKMKVLE FLAKVNGTTP CAFPTHYEEA LKDEEKAGV. It is sometimes possible for the material contained within the vial of "Melanoma-associated antigen B2 (MAGEB2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.