Major pollen allergen Car b 1 isoforms 1A and 1B Recombinant Protein

Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B

Cat. Num. AAA18669

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Major pollen allergen Car b 1 isoforms 1A and 1B; N/A; Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B; Major pollen allergen Car b 1 isoforms 1A and 1B recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-160aa; Full Length of Mature Protein
• Sequence: GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAEGIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

References

PCR based cloning and sequencing of isogenes encoding the tree pollen major allergen Car b I from Carpinus betulus, hornbeam.Nedergaard Larsen J., Stroeman P., Ipsen H.Mol. Immunol. 29:703-711(1992)

NCBI and Uniprot Product Information

• NCBI GI #: 730048
• UniProt Accession #: P38949
• Molecular Weight: 21.3 kDa
• NCBI Official Full Name: Major pollen allergen Car b 1 isoforms 1A and 1B
• UniProt Protein Name: Major pollen allergen Car b 1 isoforms 1A and 1B
• UniProt Entry Name: MPAC1_CARBE