Bioactivity
(Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM8 at 2?g/mL can bind Anti-CEACAM8 recombinant antibody, the EC50 is 19.38-21.68 ng/mL.)
Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8) Active Protein | CEACAM8 active protein
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8)(Active)
Gene Names
CEACAM8; CD67; CGM6; CD66b; NCA-95
Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8); N/A; Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8)(Active); CGM6; CEACAM8 active protein
Host
Mammalian cell
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Sequence Positions
35-320aa; Full Length of Mature Protein
Sequence
QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD$
Species
Homo sapiens (Human)
Tag
C-terminal 10xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Research Area
Cancer
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM8 at 2 ug/mL can bind Anti-CEACAM8 recombinant antibody. The EC50 is 19.38-21.68 ng/mL.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Bioactivity
(Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM8 at 2?g/mL can bind Anti-CEACAM8 recombinant antibody, the EC50 is 19.38-21.68 ng/mL.)
Bioactivity
(Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM8 at 2?g/mL can bind Anti-CEACAM8 recombinant antibody, the EC50 is 19.38-21.68 ng/mL.)
SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Related Product Information for CEACAM8 active protein
Cell surface glycoprotein that plays a role in cell adhesion in a calcium-independent manner;Mediates heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6;Heterophilic interaction with CEACAM8 occurs in activated neutrophils.
Product Categories/Family for CEACAM8 active protein
References
"Cloning of a carcinoembryonic antigen gene family member expressed in leukocytes of chronic myeloid leukemia patients and bone marrow."Berling B., Kolbinger F., Grunert F., Thompson J.A., Brombacher F., Buchegger F., Vkleist S., Zimmermann W.Cancer Res. 50:6534-6539 (1990)"Characterization of a cDNA clone encoding a new species of the nonspecific cross-reacting antigen (NCA), a member of the CEA gene family."Arakawa F., Kuroki M., Misumi Y., Oikawa S., Nakazato H., Matsuoka Y.Biochem. Biophys. Res. Commun. 166:1063-1071 (1990)"Identification of three new genes and estimation of the size of the carcinoembryonic antigen family."Khan W.N., Fraengsmyr L., Teglund S., Israelsson A., Bremer K., Hammarstroem S.Genomics 14:384-390 (1992)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38,154 Da
NCBI Official Full Name
carcinoembryonic antigen-related cell adhesion molecule 8
NCBI Official Synonym Full Names
carcinoembryonic antigen related cell adhesion molecule 8
NCBI Official Symbol
CEACAM8
NCBI Official Synonym Symbols
CD67; CGM6; CD66b; NCA-95
NCBI Protein Information
carcinoembryonic antigen-related cell adhesion molecule 8
UniProt Protein Name
Carcinoembryonic antigen-related cell adhesion molecule 8
UniProt Gene Name
CEACAM8
UniProt Synonym Gene Names
CGM6
Similar Products
Product Notes
The CEACAM8 ceacam8 (Catalog #AAA279204) is an Active Protein produced from Mammalian cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 35-320aa; Full Length of Mature Protein. The amino acid sequence is listed below: QLTIEAVPSN AAEGKEVLLL VHNLPQDPRG YNWYKGETVD ANRRIIGYVI SNQQITPGPA YSNRETIYPN ASLLMRNVTR NDTGSYTLQV IKLNLMSEEV TGQFSVHPET PKPSISSNNS NPVEDKDAVA FTCEPETQNT TYLWWVNGQS LPVSPRLQLS NGNRTLTLLS VTRNDVGPYE CEIQNPASAN FSDPVTLNVL YGPDAPTISP SDTYYHAGVN LNLSCHAASN PPSQYSWSVN GTFQQYTQKL FIPNITTKNS GSYACHTTNS ATGRNRTTVR MITVSD$. It is sometimes possible for the material contained within the vial of "Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.