Bioactivity
(Measured by its binding ability in a functional ELISA. Immobilized CD48 at 2 ?g/ml can bind Anti-CD48 rabbit monoclonal antibody, the EC50 of human CD48 protein is 0.5806-0.8463 ng/ml.)
CD48 antigen (CD48) Active Protein | CD48 active protein
Recombinant Human CD48 antigen (CD48)(Active)
Gene Names
CD48; BCM1; BLAST; hCD48; mCD48; BLAST1; SLAMF2; MEM-102
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
CD48 antigen (CD48); N/A; Recombinant Human CD48 antigen (CD48)(Active); B-lymphocyte activation marker BLAST-1; BCM1 surface antigen; Leukocyte antigen MEM-102; SLAM family member 2; SLAMF2; Signaling lymphocytic activation molecule 2; TCT.1; CD48; BCM1; BLAST1; CD48 active protein
Host
Mammalian cell
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
Sequence Positions
27-220aa; Full Length of Mature Protein
Sequence
QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS$
Species
Homo sapiens (Human)
Tag
C-terminal hFc-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Research Area
Cancer
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized CD48 at 2 ug/ml can bind Anti-CD48 rabbit monoclonal antibody, the EC50 of human CD48 protein is 0.5806-0.8463 ng/ml.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Bioactivity
(Measured by its binding ability in a functional ELISA. Immobilized CD48 at 2 ?g/ml can bind Anti-CD48 rabbit monoclonal antibody, the EC50 of human CD48 protein is 0.5806-0.8463 ng/ml.)
Bioactivity
(Measured by its binding ability in a functional ELISA. Immobilized CD48 at 2 ?g/ml can bind Anti-CD48 rabbit monoclonal antibody, the EC50 of human CD48 protein is 0.5806-0.8463 ng/ml.)
SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Related Product Information for CD48 active protein
Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation.
Product Categories/Family for CD48 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
19,429 Da
NCBI Official Full Name
CD48 antigen
NCBI Official Synonym Full Names
CD48 molecule
NCBI Official Symbol
CD48
NCBI Official Synonym Symbols
BCM1; BLAST; hCD48; mCD48; BLAST1; SLAMF2; MEM-102
NCBI Protein Information
CD48 antigen
UniProt Protein Name
CD48 antigen
UniProt Gene Name
CD48
UniProt Synonym Gene Names
BCM1; BLAST1; SLAMF2
Similar Products
Product Notes
The CD48 cd48 (Catalog #AAA279196) is an Active Protein produced from Mammalian cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-220aa; Full Length of Mature Protein. The amino acid sequence is listed below: QGHLVHMTVV SGSNVTLNIS ESLPENYKQL TWFYTFDQKI VEWDSRKSKY FESKFKGRVR LDPQSGALYI SKVQKEDNST YIMRVLKKTG NEQEWKIKLQ VLDPVPKPVI KIEKIEDMDD NCYLKLSCVI PGESVNYTWY GDKRPFPKEL QNSVLETTLM PHNYSRCYTC QVSNSVSSKN GTVCLSPPCT LARS$. It is sometimes possible for the material contained within the vial of "CD48 antigen (CD48), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.