Ephrin-A5 (EFNA5) Active Protein | EFNA5 active protein

Recombinant Human Ephrin-A5 (EFNA5) (Active)

Cat. Num. AAA243728

• Gene Names: EFNA5; AF1; EFL5; RAGS; EPLG7; GLC1M; LERK7
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ephrin-A5 (EFNA5); N/A; Recombinant Human Ephrin-A5 (EFNA5) (Active); AL-1; EPH-related receptor tyrosine kinase ligand 7; LERK-7; EFNA5 active protein

• Host: Mammalian cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4.
• Sequence Positions: 21-203aa; Full Length of Mature Protein
• Sequence: QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
• Sequence Length: 228

• Species: Human
• Tag: C-terminal FC-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized EPHA3 (MBS956024) at 2 ug/ml can bind human EFNA5, the EC50 of human EFNA5 protein is 0.8674-1.119 ng/ml.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Bioactivity

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Related Product Information for EFNA5 active protein

Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase. Activates the EPHA3 receptor to regulate cell-cell adhesion and cytoskeletal organization. With the receptor EPHA2 may regulate lens fiber cells shape and interactions and be important for lens transparency maintenance. May function actively to stimulate axon fasciculation. The interaction of EFNA5 with EPHA5 also mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Cognate/functional ligand for EPHA7, their interaction regulates brain development modulating cell-cell adhesion and repulsion.

Product Categories/Family for EFNA5 active protein

Cancer

NCBI and Uniprot Product Information

• NCBI GI #: 4503487
• NCBI GeneID: 1946
• NCBI Accession #: NP_001953.1
• NCBI GenBank Nucleotide #: NP_001953.1
• UniProt Accession #: P52803
• Molecular Weight: 50.1 kDa
• NCBI Official Full Name: ephrin-A5
• NCBI Official Synonym Full Names: ephrin A5
• NCBI Official Symbol: EFNA5
• NCBI Official Synonym Symbols: AF1; EFL5; RAGS; EPLG7; GLC1M; LERK7
• NCBI Protein Information: ephrin-A5
• UniProt Protein Name: Ephrin-A5
• UniProt Gene Name: EFNA5
• UniProt Synonym Gene Names: EPLG7; LERK7; LERK-7
• UniProt Entry Name: EFNA5_HUMAN