Ephrin Type-A Receptor 3 (EPHA3) Active Protein | EPHA3 active protein

Recombinant Human Ephrin Type-A Receptor 3 (EPHA3), Partial (Active)

Cat. Num. AAA243729

• Gene Names: EPHA3; EK4; ETK; HEK; ETK1; HEK4; TYRO4
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ephrin Type-A Receptor 3 (EPHA3); N/A; Recombinant Human Ephrin Type-A Receptor 3 (EPHA3), Partial (Active); EPH-like kinase 4; EK4; hEK4; HEK; Human embryo kinase; Tyrosine-protein kinase TYRO4; Tyrosine-protein kinase receptor ETK1; Eph-like tyrosine kinase 1; ETK; ETK1; TYRO4; EPHA3 active protein

• Host: Mammalian cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.
• Sequence Positions: 21-541aa; Partial
• Sequence: ELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFNIICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSSPPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESSQ
• Sequence Length: 983

• Species: Human
• Tag: C-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized EPHA3 at 2 ug/ml can bind human EFNA5 (MBS964964), the EC50 of the protein is 0.9734-1.179 ng/ml.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Bioactivity

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Related Product Information for EPHA3 active protein

Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Highly promiscuous for ephrin-A ligands it binds preferentially EFNA5. Upon activation by EFNA5 regulates cell-cell adhesion, cytoskeletal organization and cell migration. Plays a role in cardiac cells migration and differentiation and regulates the formation of the atrioventricular canal and septum during development probably through activation by EFNA1. Involved in the retinotectal mapping of neurons. May also control the segregation but not the guidance of motor and sensory axons during neuromuscular circuit development.

Product Categories/Family for EPHA3 active protein

Cancer

NCBI and Uniprot Product Information

• NCBI GI #: 21361241
• NCBI GeneID: 2042
• NCBI Accession #: NP_005224.2
• NCBI GenBank Nucleotide #: NP_005224.2
• UniProt Accession #: P29320
• Molecular Weight: 61.0 kDa
• NCBI Official Full Name: ephrin type-A receptor 3 isoform a
• NCBI Official Synonym Full Names: EPH receptor A3
• NCBI Official Symbol: EPHA3
• NCBI Official Synonym Symbols: EK4; ETK; HEK; ETK1; HEK4; TYRO4
• NCBI Protein Information: ephrin type-A receptor 3
• UniProt Protein Name: Ephrin type-A receptor 3
• UniProt Gene Name: EPHA3
• UniProt Synonym Gene Names: ETK; ETK1; HEK; TYRO4; EK4; hEK4; Human embryo kinase
• UniProt Entry Name: EPHA3_HUMAN