Bioactivity
(Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 ?g/ml can bind Anti-GCGR recombinant antibody, the EC50 is 3.747-6.666 ng/mL.)
Glucagon receptor (GCGR) Active Protein | GCGR active protein
Recombinant Human Glucagon receptor (GCGR), partial (Active)
Gene Names
GCGR; GGR
Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
Glucagon receptor (GCGR); N/A; Recombinant Human Glucagon receptor (GCGR), partial (Active); GL-R; GCGR active protein
Host
Mammalian cell
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Sequence Positions
26-136aa; Partial
Sequence
AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK$
Species
Homo sapiens (Human)
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Research Area
Cancer
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 ug/mL can bind Anti-GCGR recombinant antibody, the EC50 is 3.747-6.666 ng/mL.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Bioactivity
(Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 ?g/ml can bind Anti-GCGR recombinant antibody, the EC50 is 3.747-6.666 ng/mL.)
Bioactivity
(Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 ?g/ml can bind Anti-GCGR recombinant antibody, the EC50 is 3.747-6.666 ng/mL.)
SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Related Product Information for GCGR active protein
G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger system.
Product Categories/Family for GCGR active protein
References
"Conformational dimorphism of self-peptides and molecular mimicry in a disease-associated HLA-B27 subtype."Ruckert C., Fiorillo M.T., Loll B., Moretti R., Biesiadka J., Saenger W., Ziegler A., Sorrentino R., Uchanska-Ziegler B.J. Biol. Chem. 281:2306-2316(2006)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
54,009 Da
NCBI Official Full Name
glucagon receptor
NCBI Official Synonym Full Names
glucagon receptor
NCBI Official Symbol
GCGR
NCBI Official Synonym Symbols
GGR
NCBI Protein Information
glucagon receptor; GL-R
UniProt Protein Name
Glucagon receptor
UniProt Gene Name
GCGR
UniProt Synonym Gene Names
GL-R
UniProt Entry Name
GLR_HUMAN
Similar Products
Product Notes
The GCGR gcgr (Catalog #AAA279211) is an Active Protein produced from Mammalian cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-136aa; Partial. The amino acid sequence is listed below: AQVMDFLFEK WKLYGDQCHH NLSLLPPPTE LVCNRTFDKY SCWPDTPANT TANISCPWYL PWHHKVQHRF VFKRCGPDGQ WVRGPRGQPW RDASQCQMDG EEIEVQKEVA K$. It is sometimes possible for the material contained within the vial of "Glucagon receptor (GCGR), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.