Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA278921_BIOACTIVITY13.jpg Bioactivity

IGF-like family receptor 1 (IGFLR1) Active Protein | IGFLR1 active protein

Recombinant Human IGF-like family receptor 1 (IGFLR1), partial (Active)

Average rating 0.0
No ratings yet
Gene Names
IGFLR1; TMEM149; U2AF1L4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
IGF-like family receptor 1 (IGFLR1); N/A; Recombinant Human IGF-like family receptor 1 (IGFLR1), partial (Active); (Transmembrane protein 149)(U2 small nuclear RNA auxiliary factor 1-like 4); IGFLR1 active protein
Ordering
Host
Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-163aa, Partial
Sequence
SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP
Species
Homo sapiens (Human)
Endotoxin
Less than 1.0EU/ug as determined by LAL method.
Relevance
Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2ug/mL can bind Human IGFL1 , the EC50 is 4.640-5.722ng/mL.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Bioactivity

product-image-AAA278921_BIOACTIVITY13.jpg Bioactivity

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

product-image-AAA278921_SDS_PAGE15.jpg SDS-PAGE ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Product Categories/Family for IGFLR1 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,816 Da
NCBI Official Full Name
IGF-like family receptor 1
NCBI Official Synonym Full Names
IGF-like family receptor 1
NCBI Official Symbol
IGFLR1
NCBI Official Synonym Symbols
TMEM149; U2AF1L4
NCBI Protein Information
IGF-like family receptor 1; U2 small nuclear RNA auxiliary factor 1-like 4; U2(RNU2) small nuclear RNA auxiliary factor 1-like 4; transmembrane protein 149
UniProt Protein Name
IGF-like family receptor 1
UniProt Gene Name
IGFLR1
UniProt Synonym Gene Names
TMEM149; U2AF1L4
UniProt Entry Name
IGFR1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IGFLR1 igflr1 (Catalog #AAA278921) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-163aa, Partial. The amino acid sequence is listed below: SQYCGRLEYW NPDNKCCSSC LQRFGPPPCP DYEFRENCGL NDHGDFVTPP FRKCSSGQCN PDGAELCSPC GGGAVTPTPA AGGGRTPWRC RERPVPAKGH CPLTPGNPGA PSSQERSSPA SSIAWRTPEP VPQQAWPNFL P. It is sometimes possible for the material contained within the vial of "IGF-like family receptor 1 (IGFLR1), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.