IL12B&IL12A Heterodimer Active Protein | IL12B&IL12A active protein
Recombinant Human IL12B&IL12A Heterodimer Protein (Active)
Gene Names
IL12B; CLMF; NKSF; CLMF2; NKSF2; IL-12B
Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
IL12B&IL12A Heterodimer; N/A; Recombinant Human IL12B&IL12A Heterodimer Protein (Active); Cytotoxic lymphocyte maturation factor; CLMF; IL-12; NK cell stimulatory factor; NKSF; IL12B&IL12A active protein
Host
Mammalian Cell
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Sequence Positions
23-328aa (IL12B) & 23-219aa (IL12A); Heterodimer
Sequence
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS$
Species
Homo sapiens (Human)
Tag
C-terminal 10xHis-tagged & C-terminal DYKDDDDK-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Research Area
Immunology
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL12B&IL12A at 1 ug/ml/mL can bind Anti-IL12/IL23 recombinant antibody, the EC50 is 1.042-1.545 ng/mL.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Product Categories/Family for IL12B&IL12A active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
328
NCBI Official Full Name
interleukin-12 subunit beta
NCBI Official Synonym Full Names
interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40)
NCBI Official Symbol
IL12B
NCBI Official Synonym Symbols
CLMF; NKSF; CLMF2; NKSF2; IL-12B
NCBI Protein Information
interleukin-12 subunit beta; CLMF p40; IL-12 subunit p40; IL12, subunit p40; interleukin 12, p40; interleukin-12 beta chain; NK cell stimulatory factor chain 2; cytotoxic lymphocyte maturation factor 40 kDa subunit; natural killer cell stimulatory factor,
UniProt Protein Name
Interleukin-12 subunit beta
UniProt Gene Name
IL12B
UniProt Synonym Gene Names
NKSF2; IL-12B; CLMF p40; NKSF2
UniProt Entry Name
IL12B_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The IL12B&IL12A il12b (Catalog #AAA279237) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-328aa (IL12B) & 23-219aa (IL12A); Heterodimer. The amino acid sequence is listed below: IWELKKDVYV VELDWYPDAP GEMVVLTCDT PEEDGITWTL DQSSEVLGSG KTLTIQVKEF GDAGQYTCHK GGEVLSHSLL LLHKKEDGIW STDILKDQKE PKNKTFLRCE AKNYSGRFTC WWLTTISTDL TFSVKSSRGS SDPQGVTCGA ATLSAERVRG DNKEYEYSVE CQEDSACPAA EESLPIEVMV DAVHKLKYEN YTSSFFIRDI IKPDPPKNLQ LKPLKNSRQV EVSWEYPDTW STPHSYFSLT FCVQVQGKSK REKKDRVFTD KTSATVICRK NASISVRAQD RYYSSSWSEW ASVPCS&RNL PVATPDPGMF PCLHHSQNLL RAVSNMLQKA RQTLEFYPCT SEEIDHEDIT KDKTSTVEAC LPLELTKNES CLNSRETSFI TNGSCLASRK TSFMMALCLS SIYEDLKMYQ VEFKTMNAKL LMDPKRQIFL DQNMLAVIDE LMQALNFNSE TVPQKSSLEE PDFYKTKIKL CILLHAFRIR AVTIDRVMSY LNAS$. It is sometimes possible for the material contained within the vial of "IL12B&IL12A Heterodimer, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
