Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) Active Protein | ROR1 active protein

Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1), partial (Active)

Cat. Num. AAA278913

• Gene Names: ROR1; NTRKR1; dJ537F10.1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1); N/A; Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1), partial (Active); (Neurotrophic tyrosine kinase, receptor-related 1); ROR1 active protein

• Host: Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 30-403aa, Partial
• Sequence: QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

• Species: Homo sapiens (Human)
• Endotoxin: Less than 1.0EU/ug as determined by LAL method.
• Relevance: Has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo (PubMed:25029443).Receptor for ligand WNT5A which activate downstream NFkB signaling pathway and may result in the inhibition of WNT3A-mediated signaling (PubMed:25029443, PubMed:27162350). In inner ear, crucial for spiral ganglion neurons to innervate auditory hair cells (PubMed:27162350).
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized ROR1 at 2ug/mL can bind anti-ROR1 antibody , the EC50 is 0.2450-0.3416ng/mL.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Bioactivity

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Product Categories/Family for ROR1 active protein

Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 118572711
• NCBI GeneID: 4919
• UniProt Accession #: Q01973; Q5VVX6; Q66K77; Q92776
• Molecular Weight: 937
• NCBI Official Full Name: Tyrosine-protein kinase transmembrane receptor ROR1
• NCBI Official Synonym Full Names: receptor tyrosine kinase-like orphan receptor 1
• NCBI Official Symbol: ROR1
• NCBI Official Synonym Symbols: NTRKR1; dJ537F10.1
• NCBI Protein Information: tyrosine-protein kinase transmembrane receptor ROR1; neurotrophic tyrosine kinase, receptor-related 1
• UniProt Protein Name: Tyrosine-protein kinase transmembrane receptor ROR1
• UniProt Gene Name: ROR1
• UniProt Synonym Gene Names: NTRKR1
• UniProt Entry Name: ROR1_HUMAN