Interleukin-15 receptor subunit alpha (IL15RA) Active Protein | IL15RA active protein
Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial (Active)
Gene Names
IL15RA; CD215
Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
Interleukin-15 receptor subunit alpha (IL15RA); N/A; Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial (Active); IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; IL15RA active protein
Host
Mammalian Cell
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
Lyophilized powder; Lyophilized from a 0.2um sterile filtered PBS, 6% Trehalose, pH 7.4
Sequence
ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRQTPPLASVEMEAMEALPVTWGTSS
Sequence Length
31-205aa; Partial
Species
Homo sapiens (Human)
Tag
C-terminal 10xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL15RA at 2ug/mL can bind Human IL15 .The EC50 is 32.53-38.41ng/mL.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for IL15RA active protein
High-affinity receptor for interleukin-15.Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells.In neutrophils, binds and activates kinase SYK in response to IL15 stimulation.In neutrophils, required for IL15-induced phagocytosis in a SYK-dependent manner.Expression of different isoforms may alter or interfere with signal transduction.
References
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S.Nat. Genet. 36:40-45 (2004)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28,233 Da
NCBI Official Full Name
interleukin-15 receptor subunit alpha isoform 3
NCBI Official Synonym Full Names
interleukin 15 receptor, alpha
NCBI Official Symbol
IL15RA
NCBI Official Synonym Symbols
CD215
NCBI Protein Information
interleukin-15 receptor subunit alpha
UniProt Protein Name
Interleukin-15 receptor subunit alpha
UniProt Gene Name
IL15RA
UniProt Synonym Gene Names
IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; sIL-15 receptor subunit alpha; sIL-15R-alpha; sIL-15RA
UniProt Entry Name
I15RA_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The IL15RA il15ra (Catalog #AAA279381) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: ITCPPPMSVE HADIWVKSYS LYSRERYICN SGFKRKAGTS SLTECVLNKA TNVAHWTTPS LKCIRDPALV HQRPAPPSTV TTAGVTPQPE SLSPSGKEPA ASSPSSNNTA ATTAAIVPGS QLMPSKSPST GTTEISSHES SHGTPSQTTA KNWELTASAS HQPPGVYPQG HSDTTVAIST STVLLCGLSA VSLLACYLKS RQTPPLASVE MEAMEALPVT WGTSS. It is sometimes possible for the material contained within the vial of "Interleukin-15 receptor subunit alpha (IL15RA), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
