Killer cell immunoglobulin-like receptor 3DL2 (KIR3DL2) Active Protein | KIR3DL2 active protein
Recombinant Human Killer cell immunoglobulin-like receptor 3DL2 (KIR3DL2), partial (Active)
Gene Names
KIR3DL2; 3DL2; p140; NKAT4; CD158K; NKAT-4; NKAT4B; KIR-3DL2
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Killer cell immunoglobulin-like receptor 3DL2 (KIR3DL2); N/A; Recombinant Human Killer cell immunoglobulin-like receptor 3DL2 (KIR3DL2), partial (Active); CD158K; NKAT4; KIR3DL2 active protein
Host
Mammalian cell
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Sequence Positions
22-340aa; Partial
Sequence
LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLH$
Species
Homo sapiens (Human)
Tag
C-terminal 10xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Research Area
Cancer
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human KIR3DL2 at 2 ug/mL can bind Anti-KIR3DL2 recombinant antibody, the EC50 is 14.18-23.93 ng/mL.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Related Product Information for KIR3DL2 active protein
Receptor on natural killer (NK) cells and T cells for MHC class I molecules.Upon binding of peptide-free HLA-F open conformer, negatively regulates NK and T cell effector functions.Acts as a receptor on astrocytes for HLA-F. Through interaction with HLA-F, may protect motor neurons from astrocyte-induced toxicity.
Product Categories/Family for KIR3DL2 active protein
References
"Cloning of immunoglobulin-superfamily members associated with HLA-C and HLA-B recognition by human natural killer cells."Colonna M., Samaridis J.Science 268:405-408 (1995)"Killer cell inhibitory receptors specific for HLA-C and HLA-B identified by direct binding and by functional transfer."Wagtmann N., Rajagopalan S., Winter C.C., Peruzzi M., Long E.O.Immunity 3:801-809 (1995)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
48,517 Da
NCBI Official Full Name
Killer cell immunoglobulin-like receptor 3DL2
NCBI Official Synonym Full Names
killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2
NCBI Official Symbol
KIR3DL2
NCBI Official Synonym Symbols
3DL2; p140; NKAT4; CD158K; NKAT-4; NKAT4B; KIR-3DL2
NCBI Protein Information
killer cell immunoglobulin-like receptor 3DL2
UniProt Protein Name
Killer cell immunoglobulin-like receptor 3DL2
UniProt Gene Name
KIR3DL2
UniProt Synonym Gene Names
CD158K; NKAT4; NKAT-4; p70 NK receptor CL-5
Similar Products
Product Notes
The KIR3DL2 kir3dl2 (Catalog #AAA279217) is an Active Protein produced from Mammalian cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-340aa; Partial. The amino acid sequence is listed below: LMGGQDKPFL SARPSTVVPR GGHVALQCHY RRGFNNFMLY KEDRSHVPIF HGRIFQESFI MGPVTPAHAG TYRCRGSRPH SLTGWSAPSN PLVIMVTGNH RKPSLLAHPG PLLKSGETVI LQCWSDVMFE HFFLHREGIS EDPSRLVGQI HDGVSKANFS IGPLMPVLAG TYRCYGSVPH SPYQLSAPSD PLDIVITGLY EKPSLSAQPG PTVQAGENVT LSCSSWSSYD IYHLSREGEA HERRLRAVPK VNRTFQADFP LGPATHGGTY RCFGSFRALP CVWSNSSDPL LVSVTGNPSS SWPSPTEPSS KSGICRHLH$. It is sometimes possible for the material contained within the vial of "Killer cell immunoglobulin-like receptor 3DL2 (KIR3DL2), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
