Leukocyte surface antigen CD47 Active Protein | CD47 active protein
Recombinant Human Leukocyte surface antigen CD47 (CD47), partial
Gene Names
CD47; IAP; OA3; MER6
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Leukocyte surface antigen CD47; N/A; Recombinant Human Leukocyte surface antigen CD47 (CD47), partial; Antigenic surface determinant protein OA3 Integrin-associated protein; IAP; Protein MER6; CD47; CD47 active protein
Host
Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH7.4
Lyophilized or liquid (Format to be determined during the manufacturing process)
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH7.4
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-139aa, Partial
Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Species
Human
Endotoxin
Less than 1.0EU/ug as determined by LAL method.
Biological Activity
1: Measured by its binding ability in a functional ELISA. Immobilized SIRPA at 2ug/ml can bind human CD47, the EC50 of human CD47 protein is 65.91-82.42ng/ml.
2: Human SIRPA protein His/Myc tag captured on COOH chip can bind Human CD47 protein Fc tag with an affinity constant of 19.1 nM as detected by LSPR Assay.
2: Human SIRPA protein His/Myc tag captured on COOH chip can bind Human CD47 protein Fc tag with an affinity constant of 19.1 nM as detected by LSPR Assay.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C.
Store working aliquots at 4 degrees C for up to one week.
Repeated freezing and thawing is not recommended.
Store working aliquots at 4 degrees C for up to one week.
Repeated freezing and thawing is not recommended.
Related Product Information for CD47 active protein
Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins.
Product Categories/Family for CD47 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
323
NCBI Official Full Name
Leukocyte surface antigen CD47
NCBI Official Synonym Full Names
CD47 molecule
NCBI Official Symbol
CD47
NCBI Official Synonym Symbols
IAP; OA3; MER6
NCBI Protein Information
leukocyte surface antigen CD47; CD47 glycoprotein; Rh-related antigen; integrin associated protein; integrin-associated protein; integrin-associated signal transducer; antigenic surface determinant protein OA3; antigen identified by monoclonal antibody 1D
UniProt Protein Name
Leukocyte surface antigen CD47
UniProt Gene Name
CD47
UniProt Synonym Gene Names
MER6; IAP
UniProt Entry Name
CD47_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The CD47 cd47 (Catalog #AAA244029) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-139aa, Partial. The amino acid sequence is listed below: QLLFNKTKSV EFTFCNDTVV IPCFVTNMEA QNTTEVYVKW KFKGRDIYTF DGALNKSTVP TDFSSAKIEV SQLLKGDASL KMDKSDAVSH TGNYTCEVTE LTREGETIIE LKYRVVSWFS P. It is sometimes possible for the material contained within the vial of "Leukocyte surface antigen CD47, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
