Application Data
(The purity of Human CD33 was greater than 90% as determined by SEC-HPLC)
Myeloid cell surface antigen CD33 (CD33) Active Protein | CD33 active protein
Recombinant Human Myeloid cell surface antigen CD33 (CD33), partial (Active)
Gene Names
CD33; p67; SIGLEC3; SIGLEC-3
Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
Myeloid cell surface antigen CD33 (CD33); N/A; Recombinant Human Myeloid cell surface antigen CD33 (CD33), partial (Active); Sialic acid-binding Ig-like lectin 3; Siglec-3; gp67; CD33; SIGLEC3; CD33 active protein
Host
Mammalian cell
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
Sequence Positions
18-259aa; Partial
Sequence
DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH$
Species
Homo sapiens (Human)
Tag
C-terminal hFc-Myc-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Research Area
Cancer
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized CD33 at 2 ug/ml can bind Anti-CD33 rabbit monoclonal antibody, the EC50 of human CD33 protein is 4.289- 5.312 ng/ml.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Application Data
(The purity of Human CD33 was greater than 90% as determined by SEC-HPLC)
Application Data
(The purity of Human CD33 was greater than 90% as determined by SEC-HPLC)
Bioactivity
(Measured by its binding ability in a functional ELISA. Immobilized CD33 at 2 ?g/ml can bind Anti-CD33 rabbit monoclonal antibody, the EC50 of human CD33 protein is 4.289- 5.312 ng/ml)
Bioactivity
(Measured by its binding ability in a functional ELISA. Immobilized CD33 at 2 ?g/ml can bind Anti-CD33 rabbit monoclonal antibody, the EC50 of human CD33 protein is 4.289- 5.312 ng/ml)
SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Related Product Information for CD33 active protein
Sialic-acid-binding immunoglobulin-like lectin that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state. Preferentially recognizes and binds alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans. Upon engagement of ligands such as C1q or syalylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs located in CD33 cytoplasmic tail are phosphorylated by Src-like kinases such as LCK. These phosphorylations provide docking sites for the recruitment and activation of protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2. In turn, these phosphatases regulate downstream pathways through dephosphorylation of signaling molecules. One of the repressive effect of CD33 on monocyte activation requires phosphoinositide 3-kinase/PI3K.
Product Categories/Family for CD33 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
Calculated MW: 25kDa/33kDa/39kDa
Observed MW: 77kDa
Observed MW: 77kDa
NCBI Official Full Name
Myeloid cell surface antigen CD33
NCBI Official Synonym Full Names
CD33 molecule
NCBI Official Symbol
CD33
NCBI Official Synonym Symbols
p67; SIGLEC3; SIGLEC-3
NCBI Protein Information
myeloid cell surface antigen CD33; gp67; CD33 antigen (gp67); sialic acid binding Ig-like lectin 3; sialic acid-binding Ig-like lectin 3
UniProt Protein Name
Myeloid cell surface antigen CD33
UniProt Gene Name
CD33
UniProt Synonym Gene Names
SIGLEC3; Siglec-3
UniProt Entry Name
CD33_HUMAN
Similar Products
Product Notes
The CD33 cd33 (Catalog #AAA279195) is an Active Protein produced from Mammalian cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-259aa; Partial. The amino acid sequence is listed below: DPNFWLQVQE SVTVQEGLCV LVPCTFFHPI PYYDKNSPVH GYWFREGAII SRDSPVATNK LDQEVQEETQ GRFRLLGDPS RNNCSLSIVD ARRRDNGSYF FRMERGSTKY SYKSPQLSVH VTDLTHRPKI LIPGTLEPGH SKNLTCSVSW ACEQGTPPIF SWLSAAPTSL GPRTTHSSVL IITPRPQDHG TNLTCQVKFA GAGVTTERTI QLNVTYVPQN PTTGIFPGDG SGKQETRAGV VH$. It is sometimes possible for the material contained within the vial of "Myeloid cell surface antigen CD33 (CD33), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.