Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA278910_BIOACTIVITY13.jpg Bioactivity

Plexin-B1 (PLXNB1) Active Protein | PLXNB1 active protein

Recombinant Human Plexin-B1 (PLXNB1), partial (Active)

Average rating 0.0
No ratings yet
Gene Names
PLXNB1; SEP; PLXN5; PLEXIN-B1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Plexin-B1 (PLXNB1); N/A; Recombinant Human Plexin-B1 (PLXNB1), partial (Active); (Semaphorin receptor SEP); PLXNB1 active protein
Ordering
Host
Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-535aa, Partial
Sequence
LQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQ
Species
Homo sapiens (Human)
Endotoxin
Less than 1.0EU/ug as determined by LAL method.
Relevance
Receptor for SEMA4D (PubMed:19843518, PubMed:20877282, PubMed:21912513). Plays a role in GABAergic synapse development. Mediates SEMA4A- and SEMA4D-dependent inhibitory synapse development. Plays a role in RHOA activation and subsequent changes of the actin cytoskeleton (PubMed:12196628, PubMed:15210733). Plays a role in axon guidance, invasive growth and cell migration (PubMed:12198496).
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized human SEMA4D at 5ug/mL can bind human PLXNB1, the EC50 is 0.8179-1.357ug/mL.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Bioactivity

product-image-AAA278910_BIOACTIVITY13.jpg Bioactivity

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

product-image-AAA278910_SDS_PAGE15.jpg SDS-PAGE ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Product Categories/Family for PLXNB1 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
214,411 Da
NCBI Official Full Name
PLXNB1 protein
NCBI Official Synonym Full Names
plexin B1
NCBI Official Symbol
PLXNB1
NCBI Official Synonym Symbols
SEP; PLXN5; PLEXIN-B1
NCBI Protein Information
plexin-B1
UniProt Protein Name
Plexin-B1
UniProt Gene Name
PLXNB1
UniProt Synonym Gene Names
KIAA0407; PLXN5; SEP

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PLXNB1 plxnb1 (Catalog #AAA278910) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-535aa, Partial. The amino acid sequence is listed below: LQPLPPTAFT PNGTYLQHLA RDPTSGTLYL GATNFLFQLS PGLQLEATVS TGPVLDSRDC LPPVMPDECP QAQPTNNPNQ LLLVSPGALV VCGSVHQGVC EQRRLGQLEQ LLLRPERPGD TQYVAANDPA VSTVGLVAQG LAGEPLLFVG RGYTSRGVGG GIPPITTRAL WPPDPQAAFS YEETAKLAVG RLSEYSHHFV SAFARGASAY FLFLRRDLQA QSRAFRAYVS RVCLRDQHYY SYVELPLACE GGRYGLIQAA AVATSREVAH GEVLFAAFSS AAPPTVGRPP SAAAGASGAS ALCAFPLDEV DRLANRTRDA CYTREGRAED GTEVAYIEYD VNSDCAQLPV DTLDAYPCGS DHTPSPMASR VPLEATPILE WPGIQLTAVA VTMEDGHTIA FLGDSQGQLH RVYLGPGSDG HPYSTQSIQQ GSAVSRDLTF DGTFEHLYVM TQSTLLKVPV ASCAQHLDCA SCLAHRDPYC GWCVLLGRCS RRSECSRGQG PEQWLWSFQP ELGCLQ. It is sometimes possible for the material contained within the vial of "Plexin-B1 (PLXNB1), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.