Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA278919_BIOACTIVITY13.jpg Bioactivity

Recombinant Macaca fascicularis Delta-like protein 3 (DLL3) Active Protein | DLL3 active protein

Recombinant Macaca fascicularis Delta-like protein 3 (DLL3), partial (Active)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Recombinant Macaca fascicularis Delta-like protein 3 (DLL3); N/A; Recombinant Macaca fascicularis Delta-like protein 3 (DLL3), partial (Active); DLL3 active protein
Ordering
Host
Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-490aa, Partial
Sequence
AGVFELQIHSFGPGPGPGAPRSPCSARGPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPEAPAPDLPLPNGLLQVPFRDAWPGTFSLIIETWREELGDQIGGPAWSLLARVTRRRRLAAGGPWARDIQRAGAWELRFSYRARCELPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPPVCRAGCSLEHGFCEQPGECRCLEGWTGPLCMVPVSTSSCLGLRGPSSTTTGCLVPGPGPCDGNPCANGGSCSETPGSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRNCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGVSALPAAPPGLRPGDPQR
Species
Macaca fascicularis (Crab-eating macaque)(Cynomolgus monkey)
Endotoxin
Less than 1.0EU/ug as determined by LAL method.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized DLL3 at 2ug/mL can bind Anti-DLL3 Recombinant Antibody , the EC50 is 1.625-2.702ng/mL.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Bioactivity

product-image-AAA278919_BIOACTIVITY13.jpg Bioactivity

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

product-image-AAA278919_SDS_PAGE15.jpg SDS-PAGE ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Product Categories/Family for DLL3 active protein

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
50.6kDa

Similar Products

Product Notes

The DLL3 (Catalog #AAA278919) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-490aa, Partial. The amino acid sequence is listed below: AGVFELQIHS FGPGPGPGAP RSPCSARGPC RLFFRVCLKP GLSEEAAESP CALGAALSAR GPVYTEQPEA PAPDLPLPNG LLQVPFRDAW PGTFSLIIET WREELGDQIG GPAWSLLARV TRRRRLAAGG PWARDIQRAG AWELRFSYRA RCELPAVGTA CTRLCRPRSA PSRCGPGLRP CAPLEDECEA PPVCRAGCSL EHGFCEQPGE CRCLEGWTGP LCMVPVSTSS CLGLRGPSST TTGCLVPGPG PCDGNPCANG GSCSETPGSF ECTCPRGFYG LRCEVSGVTC ADGPCFNGGL CVGGADPDSA YICHCPPGFQ GSNCEKRVDR CSLQPCRNGG LCLDLGHALR CRCRAGFAGP RCEHDLDDCA GRACANGGTC VEGGGAHRCS CALGFGGRNC RERADPCAAR PCAHGGRCYA HFSGLVCACA PGYMGARCEF PVHPDGVSAL PAAPPGLRPG DPQR. It is sometimes possible for the material contained within the vial of "Recombinant Macaca fascicularis Delta-like protein 3 (DLL3), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.