Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA279224_AD11.jpg Application Data (The purity of RBP4 was greater than 90% as determined by SEC-HPLC.)

Retinol-binding protein 4 (RBP4) Active Protein | RBP4 active protein

Recombinant Human Retinol-binding protein 4 (RBP4)(Active)

Average rating 0.0
No ratings yet
Gene Names
RBP4; RDCCAS
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Retinol-binding protein 4 (RBP4); N/A; Recombinant Human Retinol-binding protein 4 (RBP4)(Active); Plasma retinol-binding protein; PRBP; RBP; RBP4 active protein
Ordering
Host
Mammalian cell
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
Sequence Positions
19-201aa; Full Length of Mature Protein
Sequence
ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL$
Species
Homo sapiens (Human)
Tag
C-terminal hFc-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Research Area
Cancer
Biological Activity
1. Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 ug/ml can bind TTR, the EC50 is 695.0-970.1 ng/ml.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Application Data

(The purity of RBP4 was greater than 90% as determined by SEC-HPLC.)

product-image-AAA279224_AD11.jpg Application Data (The purity of RBP4 was greater than 90% as determined by SEC-HPLC.)

Bioactivity

(Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 ?g/ml can bind TTR, the EC50 is 695.0-970.1 ng/ml.)

product-image-AAA279224_BIOACTIVITY13.jpg Bioactivity (Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 ?g/ml can bind TTR, the EC50 is 695.0-970.1 ng/ml.)

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

product-image-AAA279224_SDS_PAGE15.jpg SDS-PAGE ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Related Product Information for RBP4 active protein
Retinol-binding protein that mediates retinol transport in blood plasma (PubMed:5541771). Delivers retinol from the liver stores to the peripheral tissues (Probable). Transfers the bound all-trans retinol to STRA6, that then facilitates retinol transport across the cell membrane (PubMed:22665496)
Product Categories/Family for RBP4 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,010 Da
NCBI Official Full Name
retinol-binding protein 4
NCBI Official Synonym Full Names
retinol binding protein 4, plasma
NCBI Official Symbol
RBP4
NCBI Official Synonym Symbols
RDCCAS
NCBI Protein Information
retinol-binding protein 4; RBP; PRBP; plasma retinol-binding protein; retinol-binding protein 4, interstitial
UniProt Protein Name
Retinol-binding protein 4
UniProt Gene Name
RBP4
UniProt Synonym Gene Names
PRBP; RBP
UniProt Entry Name
RET4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RBP4 rbp4 (Catalog #AAA279224) is an Active Protein produced from Mammalian cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-201aa; Full Length of Mature Protein. The amino acid sequence is listed below: ERDCRVSSFR VKENFDKARF SGTWYAMAKK DPEGLFLQDN IVAEFSVDET GQMSATAKGR VRLLNNWDVC ADMVGTFTDT EDPAKFKMKY WGVASFLQKG NDDHWIVDTD YDTYAVQYSC RLLNLDGTCA DSYSFVFSRD PNGLPPEAQK IVRQRQEELC LARQYRLIVH NGYCDGRSER NLL$. It is sometimes possible for the material contained within the vial of "Retinol-binding protein 4 (RBP4), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.