Retinol-binding protein 4 (RBP4) Active Protein | RBP4 active protein

Recombinant Human Retinol-binding protein 4 (RBP4)(Active)

Cat. Num. AAA279224

• Gene Names: RBP4; RDCCAS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Synonyms: Retinol-binding protein 4 (RBP4); N/A; Recombinant Human Retinol-binding protein 4 (RBP4)(Active); Plasma retinol-binding protein; PRBP; RBP; RBP4 active protein

• Host: Mammalian cell
• Purity/Purification: Greater than 90% as determined by SDS-PAGE.
• Form/Format: Lyophilized powder; Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
• Sequence Positions: 19-201aa; Full Length of Mature Protein
• Sequence: ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL$

• Species: Homo sapiens (Human)
• Tag: C-terminal hFc-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Research Area: Cancer
• Biological Activity: 1. Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 ug/ml can bind TTR, the EC50 is 695.0-970.1 ng/ml.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.; We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Application Data

(The purity of RBP4 was greater than 90% as determined by SEC-HPLC.)

Bioactivity

(Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 ?g/ml can bind TTR, the EC50 is 695.0-970.1 ng/ml.)

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Related Product Information for RBP4 active protein

Retinol-binding protein that mediates retinol transport in blood plasma (PubMed:5541771). Delivers retinol from the liver stores to the peripheral tissues (Probable). Transfers the bound all-trans retinol to STRA6, that then facilitates retinol transport across the cell membrane (PubMed:22665496)

Product Categories/Family for RBP4 active protein

Active Protein & In Stock Protein

NCBI and Uniprot Product Information

• NCBI GI #: 55743122
• NCBI GeneID: 5950
• NCBI Accession #: NP_006735.2
• NCBI GenBank Nucleotide #: NM_006744.3
• UniProt Accession #: P02753; O43478; O43479; Q5VY24; Q8WWA3; Q9P178; D3DR38
• Molecular Weight: 23,010 Da
• NCBI Official Full Name: retinol-binding protein 4
• NCBI Official Synonym Full Names: retinol binding protein 4, plasma
• NCBI Official Symbol: RBP4
• NCBI Official Synonym Symbols: RDCCAS
• NCBI Protein Information: retinol-binding protein 4; RBP; PRBP; plasma retinol-binding protein; retinol-binding protein 4, interstitial
• UniProt Protein Name: Retinol-binding protein 4
• UniProt Gene Name: RBP4
• UniProt Synonym Gene Names: PRBP; RBP
• UniProt Entry Name: RET4_HUMAN