Bioactivity
(Measured by its binding ability in a functional ELISA. Immobilized Rabbit TFPI at 1 ?g/ml can bind Anti-TFPI recombinant antibody, the EC50 is 2.281-3.783 ng/mL.)
Tissue factor pathway inhibitor (TFPI) Active Protein | TFPI active protein
Recombinant Rabbit Tissue factor pathway inhibitor (TFPI)(Active)
Gene Names
TFPI; EPI; LACI
Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
Tissue factor pathway inhibitor (TFPI); N/A; Recombinant Rabbit Tissue factor pathway inhibitor (TFPI)(Active); TFPI; Extrinsic pathway inhibitor; EPI; Lipoprotein-associated coagulation inhibitor; LACI; TFPI active protein
Host
Mammalian cell
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Sequence Positions
25-300aa; Full Length of Mature Protein
Sequence
AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT
Species
Oryctolagus cuniculus (Rabbit)
Tag
N-terminal 10xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Research Area
Cardiovascular
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Rabbit TFPI at 1 ug/mL can bind Anti-TFPI recombinant antibody, the EC50 is 2.281-3.783 ng/mL.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Bioactivity
(Measured by its binding ability in a functional ELISA. Immobilized Rabbit TFPI at 1 ?g/ml can bind Anti-TFPI recombinant antibody, the EC50 is 2.281-3.783 ng/mL.)
Bioactivity
(Measured by its binding ability in a functional ELISA. Immobilized Rabbit TFPI at 1 ?g/ml can bind Anti-TFPI recombinant antibody, the EC50 is 2.281-3.783 ng/mL.)
SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Related Product Information for TFPI active protein
Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.
Product Categories/Family for TFPI active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34,436 Da
NCBI Official Full Name
tissue factor pathway inhibitor
NCBI Official Symbol
TFPI
NCBI Official Synonym Symbols
EPI; LACI
NCBI Protein Information
tissue factor pathway inhibitor; extrinsic pathway inhibitor; lipoprotein-associated coagulation inhibitor
UniProt Protein Name
Tissue factor pathway inhibitor
UniProt Gene Name
TFPI
UniProt Synonym Gene Names
TFPI; EPI; LACI
Similar Products
Product Notes
The TFPI tfpi (Catalog #AAA279230) is an Active Protein produced from Mammalian cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-300aa; Full Length of Mature Protein. The amino acid sequence is listed below: AAEEDEEFTN ITDIKPPLQK PTHSFCAMKV DDGPCRAYIK RFFFNILTHQ CEEFIYGGCE GNENRFESLE ECKEKCARDY PKMTTKLTFQ KGKPDFCFLE EDPGICRGYI TRYFYNNQSK QCERFKYGGC LGNLNNFESL EECKNTCENP TSDFQVDDHR TQLNTVNNTL INQPTKAPRR WAFHGPSWCL PPADRGLCQA NEIRFFYNAI IGKCRPFKYS GCGGNENNFT SKKACITACK KGFIPKSIKG GLIKTKRKKK KQPVKITYVE TFVKKT. It is sometimes possible for the material contained within the vial of "Tissue factor pathway inhibitor (TFPI), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.