Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA279227_BIOACTIVITY13.jpg Bioactivity (Measured by its binding ability in a functional ELISA. Immobilized Human TROP2 at 2 ?gg/mL can bind Anti-TROP2 recombinant antibody, the EC50 is 0.9108-1.640 ng/mL.)

Tumor-associated calcium signal transducer 2 (TACSTD2) Active Protein | TACSTD2 active protein

Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2), partial (Active)

Gene Names
TACSTD2; EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1
Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
Tumor-associated calcium signal transducer 2 (TACSTD2); N/A; Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2), partial (Active); Cell surface glycoprotein Trop-2; Membrane component chromosome 1 surface marker 1; Pancreatic carcinoma marker protein GA733-1; TACSTD2 active protein
Ordering
Host
Mammalian Cell
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Sequence Positions
31-274aa; Partial
Sequence
QDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT$
Species
Homo sapiens (Human)
Tag
C-terminal 10xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Research Area
Cancer
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TROP2 at 2 ug/mL can bind Anti-TROP2 recombinant antibody, the EC50 is 0.9108-1.640 ng/mL.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Bioactivity

(Measured by its binding ability in a functional ELISA. Immobilized Human TROP2 at 2 ?gg/mL can bind Anti-TROP2 recombinant antibody, the EC50 is 0.9108-1.640 ng/mL.)

product-image-AAA279227_BIOACTIVITY13.jpg Bioactivity (Measured by its binding ability in a functional ELISA. Immobilized Human TROP2 at 2 ?gg/mL can bind Anti-TROP2 recombinant antibody, the EC50 is 0.9108-1.640 ng/mL.)

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

product-image-AAA279227_SDS_PAGE15.jpg SDS-PAGE ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Related Product Information for TACSTD2 active protein
May function as a growth factor receptor.
Product Categories/Family for TACSTD2 active protein
References
"A missense mutation in the M1S1 gene found in a turkish patient with gelatinous droplike corneal dystrophy."Yildirim N., Muslumanoglu H., Isiksoy S., Sahin A., Baycu C., Artan S.Cornea 26:1017-1020(2007)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,709 Da
NCBI Official Full Name
tumor-associated calcium signal transducer 2
NCBI Official Synonym Full Names
tumor-associated calcium signal transducer 2
NCBI Official Symbol
TACSTD2
NCBI Official Synonym Symbols
EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1
NCBI Protein Information
tumor-associated calcium signal transducer 2; epithelial glycoprotein-1; cell surface glycoprotein TROP2; cell surface glycoprotein Trop-2; pancreatic carcinoma marker protein GA7331; pancreatic carcinoma marker protein GA733-1; gastrointestinal tumor-ass
UniProt Protein Name
Tumor-associated calcium signal transducer 2
UniProt Gene Name
TACSTD2
UniProt Synonym Gene Names
GA733-1; M1S1; TROP2
UniProt Entry Name
TACD2_HUMAN

Similar Products

Product Notes

The TACSTD2 tacstd2 (Catalog #AAA279227) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 31-274aa; Partial. The amino acid sequence is listed below: QDNCTCPTNK MTVCSPDGPG GRCQCRALGS GMAVDCSTLT SKCLLLKARM SAPKNARTLV RPSEHALVDN DGLYDPDCDP EGRFKARQCN QTSVCWCVNS VGVRRTDKGD LSLRCDELVR THHILIDLRH RPTAGAFNHS DLDAELRRLF RERYRLHPKF VAAVHYEQPT IQIELRQNTS QKAAGDVDIG DAAYYFERDI KGESLFQGRG GLDLRVRGEP LQVERTLIYY LDEIPPKFSM KRLT$. It is sometimes possible for the material contained within the vial of "Tumor-associated calcium signal transducer 2 (TACSTD2), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.