Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA279194_BIOACTIVITY13.jpg Bioactivity (Measured by its binding ability in a functional ELISA. Immobilized Human ANGPT2 at 2 ?g/ml can bind anti-ANGPT2 recombinant antibody, the EC50 is 0.6666-0.8876 ng/mL.)

Angiopoietin-2 (ANGPT2) Active Protein | ANGPT2 active protein

Recombinant Human Angiopoietin-2 (ANGPT2)(Active)

Average rating 0.0
No ratings yet
Gene Names
ANGPT2; ANG2; AGPT2
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Angiopoietin-2 (ANGPT2); N/A; Recombinant Human Angiopoietin-2 (ANGPT2)(Active); ANG-2; ANGPT2 active protein
Ordering
Host
Mammalian Cell
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Sequence Positions
19-496aa; Full Length of Mature Protein
Sequence
YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF$
Species
Homo sapiens (Human)
Tag
C-terminal 10xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Research Area
Cardiovascular
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ANGPT2 at 2 ug/mL can bind anti-ANGPT2 recombinant antibody, the EC50 is 0.6666-0.8876 ng/mL.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Bioactivity

(Measured by its binding ability in a functional ELISA. Immobilized Human ANGPT2 at 2 ?g/ml can bind anti-ANGPT2 recombinant antibody, the EC50 is 0.6666-0.8876 ng/mL.)

product-image-AAA279194_BIOACTIVITY13.jpg Bioactivity (Measured by its binding ability in a functional ELISA. Immobilized Human ANGPT2 at 2 ?g/ml can bind anti-ANGPT2 recombinant antibody, the EC50 is 0.6666-0.8876 ng/mL.)

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

product-image-AAA279194_SDS_PAGE15.jpg SDS-PAGE ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Related Product Information for ANGPT2 active protein
Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal.
Product Categories/Family for ANGPT2 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
285
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56,919 Da
NCBI Official Full Name
angiopoietin-2 isoform c
NCBI Official Synonym Full Names
angiopoietin 2
NCBI Official Symbol
ANGPT2
NCBI Official Synonym Symbols
ANG2; AGPT2
NCBI Protein Information
angiopoietin-2; ANG-2; Tie2-ligand; angiopoietin-2B; angiopoietin-2a
UniProt Protein Name
Angiopoietin-2
UniProt Gene Name
ANGPT2
UniProt Synonym Gene Names
ANG-2
UniProt Entry Name
ANGP2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ANGPT2 angpt2 (Catalog #AAA279194) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-496aa; Full Length of Mature Protein. The amino acid sequence is listed below: YNNFRKSMDS IGKKQYQVQH GSCSYTFLLP EMDNCRSSSS PYVSNAVQRD APLEYDDSVQ RLQVLENIME NNTQWLMKLE NYIQDNMKKE MVEIQQNAVQ NQTAVMIEIG TNLLNQTAEQ TRKLTDVEAQ VLNQTTRLEL QLLEHSLSTN KLEKQILDQT SEINKLQDKN SFLEKKVLAM EDKHIIQLQS IKEEKDQLQV LVSKQNSIIE ELEKKIVTAT VNNSVLQKQQ HDLMETVNNL LTMMSTSNSA KDPTVAKEEQ ISFRDCAEVF KSGHTTNGIY TLTFPNSTEE IKAYCDMEAG GGGWTIIQRR EDGSVDFQRT WKEYKVGFGN PSGEYWLGNE FVSQLTNQQR YVLKIHLKDW EGNEAYSLYE HFYLSSEELN YRIHLKGLTG TAGKISSISQ PGNDFSTKDG DNDKCICKCS QMLTGGWWFD ACGPSNLNGM YYPQRQNTNK FNGIKWYYWK GSGYSLKATT MMIRPADF$. It is sometimes possible for the material contained within the vial of "Angiopoietin-2 (ANGPT2), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.