Mast cell protease 4 Recombinant Protein | Mcpt4 recombinant protein

Recombinant Mouse Mast cell protease 4

Cat. Num. AAA18631

• Gene Names: Mcpt4; Mcp4; Mcp-4; MMCP-4; MMCP-4A; MMCP-4B
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Mast cell protease 4; N/A; Recombinant Mouse Mast cell protease 4; MSMCP; Myonase; Serosal mast cell protease; Mcpt4 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 21-246aa; Full Length of Mature Protein
• Sequence: IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Mcpt4 recombinant protein

Has chymotrypsin-like activity. Hydrolyzes the amide bonds of synthetic substrates having Tyr and Phe residues at the P1 position. Preferentially hydrolyzes the 'Tyr-4-|-Ile-5' bond of angiotensin I and the 'Phe-20-|-Ala-21' bond of amyloid beta-protein, and is less active towards the 'Phe-8-|-His-9' bond of angiotensin I and the 'Phe-4-|-Ala-5' and 'Tyr-10-|-Glu-11' bonds of amyloid beta-protein. Involved in thrombin regulation and fibronectin processing.

References

Cloning of the cDNA and gene for mouse mast cell protease 4. Demonstration of its late transcription in mast cell subclasses and analysis of its homology to subclass-specific neutral proteases of the mouse and rat.Serafin W.E., Sullivan T.P., Conder G.A., Ebrahimi A., Marcham P., Johnson S.S., Austen K.F., Reynolds D.S.J. Biol. Chem. 266:1934-1941(1991) Independent influence of strain difference and mi transcription factor on the expression of mouse mast cell chymases.Ge Y., Jippo T., Lee Y.-M., Adachi S., Kitamura Y.Am. J. Pathol. 158:281-292(2001) Cloning and structural analysis of MMCP-1, MMCP-4 and MMCP-5, three mouse mast cell-specific serine proteases.Huang R., Blom T., Hellman L.Eur. J. Immunol. 21:1611-1621(1991) Purification and characterization of myonase from X-chromosome linked muscular dystrophic mouse skeletal muscle.Hori S., Ohtani S., Hori C., Nokihara K.J. Biochem. 123:650-658(1998) Different mouse mast cell populations express various combinations of at least six distinct mast cell serine proteases.Reynolds D.S., Stevens R.L., Lane W.S., Carr M.H., Austen K.F., Serafin W.E.Proc. Natl. Acad. Sci. U.S.A. 87:3230-3234(1990) Biochemical and immunological characterization of multiple glycoforms of mouse mast cell protease 1 comparison with an isolated murine serosal mast cell protease (MMCP-4) .Newlands G.F.J., Knox D.P., Pirie-Shepherd S.R., Miller H.R.P.Biochem. J. 294:127-135(1993) The chymase, mouse mast cell protease 4, constitutes the major chymotrypsin-like activity in peritoneum and ear tissue. A role for mouse mast cell protease 4 in thrombin regulation and fibronectin turnover.Tchougounova E., Pejler G., Abrink M.J. Exp. Med. 198:423-431(2003)

NCBI and Uniprot Product Information

• NCBI GI #: 114205406
• NCBI GeneID: 17227
• NCBI Accession #: NP_034909.2
• NCBI GenBank Nucleotide #: NM_010779.2
• UniProt Accession #: P21812; Q9EPQ9; Q9EQT2
• Molecular Weight: 27.1 kDa
• NCBI Official Full Name: mast cell protease 4
• NCBI Official Synonym Full Names: mast cell protease 4
• NCBI Official Symbol: Mcpt4
• NCBI Official Synonym Symbols: Mcp4; Mcp-4; MMCP-4; MMCP-4A; MMCP-4B
• NCBI Protein Information: mast cell protease 4
• UniProt Protein Name: Mast cell protease 4
• UniProt Gene Name: Mcpt4
• UniProt Synonym Gene Names: mMCP-4
• UniProt Entry Name: MCPT4_MOUSE