Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18631_SDS_PAGE.jpg SDS-PAGE

Mast cell protease 4 Recombinant Protein | Mcpt4 recombinant protein

Recombinant Mouse Mast cell protease 4

Gene Names
Mcpt4; Mcp4; Mcp-4; MMCP-4; MMCP-4A; MMCP-4B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mast cell protease 4; N/A; Recombinant Mouse Mast cell protease 4; MSMCP; Myonase; Serosal mast cell protease; Mcpt4 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-246aa; Full Length of Mature Protein
Sequence
IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA18631_SDS_PAGE.jpg SDS-PAGE
Related Product Information for Mcpt4 recombinant protein
Has chymotrypsin-like activity. Hydrolyzes the amide bonds of synthetic substrates having Tyr and Phe residues at the P1 position. Preferentially hydrolyzes the 'Tyr-4-|-Ile-5' bond of angiotensin I and the 'Phe-20-|-Ala-21' bond of amyloid beta-protein, and is less active towards the 'Phe-8-|-His-9' bond of angiotensin I and the 'Phe-4-|-Ala-5' and 'Tyr-10-|-Glu-11' bonds of amyloid beta-protein. Involved in thrombin regulation and fibronectin processing.
References
Cloning of the cDNA and gene for mouse mast cell protease 4. Demonstration of its late transcription in mast cell subclasses and analysis of its homology to subclass-specific neutral proteases of the mouse and rat.Serafin W.E., Sullivan T.P., Conder G.A., Ebrahimi A., Marcham P., Johnson S.S., Austen K.F., Reynolds D.S.J. Biol. Chem. 266:1934-1941(1991) Independent influence of strain difference and mi transcription factor on the expression of mouse mast cell chymases.Ge Y., Jippo T., Lee Y.-M., Adachi S., Kitamura Y.Am. J. Pathol. 158:281-292(2001) Cloning and structural analysis of MMCP-1, MMCP-4 and MMCP-5, three mouse mast cell-specific serine proteases.Huang R., Blom T., Hellman L.Eur. J. Immunol. 21:1611-1621(1991) Purification and characterization of myonase from X-chromosome linked muscular dystrophic mouse skeletal muscle.Hori S., Ohtani S., Hori C., Nokihara K.J. Biochem. 123:650-658(1998) Different mouse mast cell populations express various combinations of at least six distinct mast cell serine proteases.Reynolds D.S., Stevens R.L., Lane W.S., Carr M.H., Austen K.F., Serafin W.E.Proc. Natl. Acad. Sci. U.S.A. 87:3230-3234(1990) Biochemical and immunological characterization of multiple glycoforms of mouse mast cell protease 1 comparison with an isolated murine serosal mast cell protease (MMCP-4) .Newlands G.F.J., Knox D.P., Pirie-Shepherd S.R., Miller H.R.P.Biochem. J. 294:127-135(1993) The chymase, mouse mast cell protease 4, constitutes the major chymotrypsin-like activity in peritoneum and ear tissue. A role for mouse mast cell protease 4 in thrombin regulation and fibronectin turnover.Tchougounova E., Pejler G., Abrink M.J. Exp. Med. 198:423-431(2003)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27.1 kDa
NCBI Official Full Name
mast cell protease 4
NCBI Official Synonym Full Names
mast cell protease 4
NCBI Official Symbol
Mcpt4
NCBI Official Synonym Symbols
Mcp4; Mcp-4; MMCP-4; MMCP-4A; MMCP-4B
NCBI Protein Information
mast cell protease 4
UniProt Protein Name
Mast cell protease 4
UniProt Gene Name
Mcpt4
UniProt Synonym Gene Names
mMCP-4
UniProt Entry Name
MCPT4_MOUSE

Similar Products

Product Notes

The Mcpt4 mcpt4 (Catalog #AAA18631) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-246aa; Full Length of Mature Protein. The amino acid sequence is listed below: IIGGVESRPH SRPYMAHLEI TTERGFTATC GGFLITRQFV MTAAHCSGRE ITVTLGAHDV SKTESTQQKI KVEKQIVHPK YNFYSNLHDI MLLKLQKKAK ETPSVNVIPL PRPSDFIKPG KMCRAAGWGR TGVTEPTSDT LREVKLRIMD KEACKNYWHY DYNLQVCVGS PRKKRSAYKG DSGGPLLCAG VAHGIVSYGR GDAKPPAVFT RISSYVPWIN RVIKGE . It is sometimes possible for the material contained within the vial of "Mast cell protease 4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.