Malate dehydrogenase Recombinant Protein | MDHA recombinant protein
Recombinant Human Malate dehydrogenase, cytoplasmic
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Malate dehydrogenase; N/A; Recombinant Human Malate dehydrogenase, cytoplasmic; Cytosolic malate dehydrogenase; Diiodophenylpyruvate reductase (EC:1.1.1.96); MDHA recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-333aa; Full Length
Sequence
SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSS
Sequence Length
352
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Product Categories/Family for MDHA recombinant protein
References
Molecular cloning and mapping of a human cDNA for cytosolic malate dehydrogenase (MDH1)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
63.2 kDa
NCBI Official Full Name
malate dehydrogenase, cytoplasmic isoform 2
UniProt Protein Name
Malate dehydrogenase, cytoplasmic
UniProt Gene Name
MDH1
UniProt Synonym Gene Names
MDHA
UniProt Entry Name
MDHC_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The MDHA mdh1 (Catalog #AAA81631) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-333aa; Full Length. The amino acid sequence is listed below: SEPIRVLVTG AAGQIAYSLL YSIGNGSVFG KDQPIILVLL DITPMMGVLD GVLMELQDCA LPLLKDVIAT DKEDVAFKDL DVAILVGSMP RREGMERKDL LKANVKIFKS QGAALDKYAK KSVKVIVVGN PANTNCLTAS KSAPSIPKEN FSCLTRLDHN RAKAQIALKL GVTANDVKNV IIWGNHSSTQ YPDVNHAKVK LQGKEVGVYE ALKDDSWLKG EFVTTVQQRG AAVIKARKLS SAMSAAKAIC DHVRDIWFGT PEGEFVSMGV ISDGNSYGVP DDLLYSFPVV IKNKTWKFVE GLPINDFSRE KMDLTAKELT EEKESAFEFL SS. It is sometimes possible for the material contained within the vial of "Malate dehydrogenase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
