E3 ubiquitin-protein ligase Mdm2 Recombinant Protein | MDM2 recombinant protein
Recombinant mouse E3 ubiquitin-protein ligase Mdm2
Gene Names
Mdm2; Mdm-2; AA415488; 1700007J15Rik
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase Mdm2; N/A; Recombinant mouse E3 ubiquitin-protein ligase Mdm2; Double minute 2 proteinOncoprotein Mdm2p53-binding protein Mdm2; MDM2 recombinant protein
Host
E Coli
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
20mM Tris-HCl based buffer, pH8.0
Sequence Positions
Full Length, 1-489aa
Sequence
MCNTNMSVSTEGAASTSQIPASEQETLVRPKPLLLKLLKSVGAQNDTYTMKEIIFYIGQYIMTKRLYDEKQQHIV
YCSNDLLGDVFGVPSFSVKEHRKIYAMIYRNLVAVSQQDSGTSLSESRRQPEGGSDLKDPLQAPPEEKPSSS
DLISRLSTSSRRRSISETEENTDELPGERHRKRRRSLSFDPSLGLCELREMCSGGSSSSSSSSSESTETPSHQ
DLDDGVSEHSGDCLDQDSVSDQFSVEFEVESLDSEDYSLSDEGHELSDEDDEVYRVTVYQTGESDTDSFEG
DPEISLADYWKCTSCNEMNPPLPSHCKRCWTLRENWLPDDKGKDKVEISEKAKLENSAQAEEGLDVPDGKKL
TENDAKEPCAEEDSEEKAEQTPLSQESDDYSQPSTSSSIVYSSQESVKELKEETQDKDESVESSFSLNAIEPC
VICQGRPKNGCIVHGKTGHLMSCFTCAKKLKKRNKPCPVCRQPIQMIVLTYFN
Target Name
MDM2
Target Species
Mouse
Tag Info
His-tag
Preparation and Storage
Store at -20°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Related Product Information for MDM2 recombinant protein
E3 ubiquitin-protein ligase that mediates ubiquitination of p53/TP53, leading to its degradation by the proteasome. Inhibits p53/TP53- and p73/TP73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Also acts as a ubiquitin ligase E3 toward itself and ARRB1. Permits the nuclear export of p53/TP53. Promotes proteasome-dependent ubiquitin-independent degradation of retinoblastoma RB1 protein. Inhibits DAXX-mediated apoptosis by inducing its ubiquitination and degradation. Component of the TRIM28/KAP1-MDM2-p53/TP53 complex involved in stabilizing p53/TP53. Also component of the TRIM28/KAP1-ERBB4-MDM2 complex which links growth factor and DNA damage response pathways. Mediates ubiquitination and subsequent proteasome degradation of DYRK2 in nucleus. Ubiquitinates IGF1R and SNAI1 and promotes th to proteasomal degradation.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
58.6kD
NCBI Official Full Name
E3 ubiquitin-protein ligase Mdm2 isoform 2
NCBI Official Synonym Full Names
transformed mouse 3T3 cell double minute 2
NCBI Official Symbol
Mdm2
NCBI Official Synonym Symbols
Mdm-2; AA415488; 1700007J15Rik
NCBI Protein Information
E3 ubiquitin-protein ligase Mdm2
UniProt Protein Name
E3 ubiquitin-protein ligase Mdm2
UniProt Gene Name
Mdm2
Similar Products
Product Notes
The MDM2 mdm2 (Catalog #AAA309734) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Full Length, 1-489aa. The amino acid sequence is listed below: MCNTNMSVST EGAASTSQIP ASEQETLVRP KPLLLKLLKS VGAQNDTYTM KEIIFYIGQY IMTKRLYDEK QQHIV YCSN DLLGDVFGVP SFSVKEHRKI YAMIYRNLVA VSQQDSGTSL SESRRQPEGG SDLKDPLQAP PEEKPSSS D LISRLSTSSR RRSISETEEN TDELPGERHR KRRRSLSFDP SLGLCELREM CSGGSSSSSS SSSESTETPS HQ DLDDGVS EHSGDCLDQD SVSDQFSVEF EVESLDSEDY SLSDEGHELS DEDDEVYRVT VYQTGESDTD SFEG DPEIS LADYWKCTSC NEMNPPLPSH CKRCWTLREN WLPDDKGKDK VEISEKAKLE NSAQAEEGLD VPDGKKL TE NDAKEPCAEE DSEEKAEQTP LSQESDDYSQ PSTSSSIVYS SQESVKELKE ETQDKDESVE SSFSLNAIEP C VICQGRPK NGCIVHGKTG HLMSCFTCAK KLKKRNKPCP VCRQPIQMIV LTYFN. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase Mdm2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.