Malic Enzyme 2 Recombinant Protein | ME2 recombinant protein
Recombinant Human Malic Enzyme 2
Gene Names
ME2; ODS1
Purity
Greater than 95.0% as determined by SDS-PAGE.
Synonyms
Malic Enzyme 2; N/A; Recombinant Human Malic Enzyme 2; ME2 Human; Malic Enzyme 2 Human Recombinant; Malic enzyme 2 NAD(+)-dependent mitochondrial; NAD-ME; ODS1; Malate Dehydrogenase; NAD-dependent malic enzyme mitochondrial; pyruvic-malic carboxylase; Malic enzyme 2; EC 1.1.1.38; EC 1.1.1; ME2 recombinant protein
Purity/Purification
Greater than 95.0% as determined by SDS-PAGE.
Form/Format
The protein was Lyophilized from a 0.2 um filtered concentrated solution in 20mM Tris, 150mM NaCl, 1mM ß-mercaptoethanol, 1mM EDTA, pH8.0.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITEHHHHHH
Source
Escherichia Coli
Solubility
It is recommended to reconstitute the lyophilized ME2 in sterile 18M Omega-cm H2O not less than 100 ug/mL, which can then be further diluted to other aqueous solutions.
Preparation and Storage
Lyophilized ME2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution ME2 should be stored at 4°C between 2-7 days and for future use below -18°C .
Please prevent freeze-thaw cycles.
Please prevent freeze-thaw cycles.
Related Product Information for ME2 recombinant protein
Description: ME2 Human Recombinant produced in E Coli is a single, non-glycosylated polypeptide chain containing 573 amino acids and having a total molecular mass of 64.4kDa.ME2 is purified by proprietary chromatographic techniques.
Product Categories/Family for ME2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
NAD-dependent malic enzyme, mitochondrial isoform 2
NCBI Official Synonym Full Names
malic enzyme 2, NAD(+)-dependent, mitochondrial
NCBI Official Symbol
ME2
NCBI Official Synonym Symbols
ODS1
NCBI Protein Information
NAD-dependent malic enzyme, mitochondrial; NAD-ME; malate dehydrogenase; pyruvic-malic carboxylase
UniProt Protein Name
NAD-dependent malic enzyme, mitochondrial
UniProt Gene Name
ME2
UniProt Synonym Gene Names
NAD-ME
UniProt Entry Name
MAOM_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ME2 me2 (Catalog #AAA38613) is a Recombinant Protein and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MLHIKEKGKP LMLNPRTNKG MAFTLQERQM LGLQGLLPPK IETQDIQALR FHRNLKKMTS PLEKYIYIMG IQERNEKLFY RILQDDIESL MPIVYTPTVG LACSQYGHIF RRPKGLFISI SDRGHVRSIV DNWPENHVKA VVVTDGERIL GLGDLGVYGM GIPVGKLCLY TACAGIRPDR CLPVCIDVGT DNIALLKDPF YMGLYQKRDR TQQYDDLIDE FMKAITDRYG RNTLIQFEDF GNHNAFRFLR KYREKYCTFN DDIQGTAAVA LAGLLAAQKV ISKPISEHKI LFLGAGEAAL GIANLIVMSM VENGLSEQEA QKKIWMFDKY GLLVKGRKAK IDSYQEPFTH SAPESIPDTF EDAVNILKPS TIIGVAGAGR LFTPDVIRAM ASINERPVIF ALSNPTAQAE CTAEEAYTLT EGRCLFASGS PFGPVKLTDG RVFTPGQGNN VYIFPGVALA VILCNTRHIS DSVFLEAAKA LTSQLTDEEL AQGRLYPPLA NIQEVSINIA IKVTEYLYAN KMAFRYPEPE DKAKYVKERT WRSEYDSLLP DVYEWPESAS SPPVITEHHH HHH. It is sometimes possible for the material contained within the vial of "Malic Enzyme 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.