Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA55954_SDS_PAGE15.jpg SDS-PAGE

MFG-E8 recombinant protein

Recombinant Human MFG-E8 Protein

Average rating 0.0
No ratings yet
Gene Names
MFGE8; BA46; HMFG; MFGM; SED1; hP47; EDIL1; MFG-E8; SPAG10; OAcGD3S; HsT19888
Purity
> 90 % as determined by SDS-PAGE.
Synonyms
MFG-E8; N/A; Recombinant Human MFG-E8 Protein; HMFG; MFGM; SED1; BA46; EDIL1; OAcGD3S; SPAG10; hP47; Medin; Lactadherin; Sperm Associated Antigen 10; Sperm Surface Protein hP47; Milk fat globule-EGF factor 8.; MFG-E8 recombinant protein
Ordering
Host
E Coli
Purity/Purification
> 90 % as determined by SDS-PAGE.
Form/Format
100 mM Tris-HCI, 0.4 M Arg, pH 8.0, with 50% glycerol.
Concentration
2.0 mg/mL (varies by lot)
Sequence Positions
24-387
Sequence
LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC
Species
Human
Source
Human
Protein Residue
N-Terminal 6*His-SUMO-tagged
Usage
MFGEB Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.
Preparation and Storage
Store it under sterile conditions at -20°C to -80°C upon receiving.
Stability: The recommended protein is stable for up to 6-12 months from date of receipt at -80°C.
Recommend to aliquot the protein into smaller quantities for optimal storage.
**Avoid repeated freeze-thaw cycles.

SDS-PAGE

product-image-AAA55954_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for MFG-E8 recombinant protein
MFGE8 is a protein which is encoded by the MFGE8 gene. MFGE8 is secreted protein found in vertebrates, including mammals as well as birds.Mfge8 contains a phosphatidylserine (PS) binding domain, as well as an Arginine-GlycineAspartic acid motif, which enables the binding to integrins. MFGE8 binds PS, which is exposed on the surface of apoptotic cells. Opsonization of the apoptotic cells and binding to integrins on the surface of phagocytic cells, mediates the engulfment of the dead cell. MFGE8, when engaged by phospholipids, bound to cells via its RGD motif. It bound particularly strongly to cells expressing alpha-V-beta-3 integrin. The NIH 3T3 cell transformants that expressed a high level of alpha-V-beta-3 integrin engulfed apoptotic cells when MFGE8 was added.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted MW: 56.8 kDa
Observed MW: 57 kDa
NCBI Official Full Name
lactadherin isoform a preproprotein
NCBI Official Synonym Full Names
milk fat globule-EGF factor 8 protein
NCBI Official Symbol
MFGE8
NCBI Official Synonym Symbols
BA46; HMFG; MFGM; SED1; hP47; EDIL1; MFG-E8; SPAG10; OAcGD3S; HsT19888
NCBI Protein Information
lactadherin
UniProt Protein Name
Lactadherin
UniProt Gene Name
MFGE8
UniProt Synonym Gene Names
MFG-E8
UniProt Entry Name
MFGM_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MFG-E8 mfge8 (Catalog #AAA55954) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-387. The amino acid sequence is listed below: LDICSKNPCH NGGLCEEISQ EVRGDVFPSY TCTCLKGYAG NHCETKCVEP LGMENGNIAN SQIAASSVRV TFLGLQHWVP ELARLNRAGM VNAWTPSSND DNPWIQVNLL RRMWVTGVVT QGASRLASHE YLKAFKVAYS LNGHEFDFIH DVNKKHKEFV GNWNKNAVHV NLFETPVEAQ YVRLYPTSCH TACTLRFELL GCELNGCANP LGLKNNSIPD KQITASSSYK TWGLHLFSWN PSYARLDKQG NFNAWVAGSY GNDQWLQVDL GSSKEVTGII TQGARNFGSV QFVASYKVAY SNDSANWTEY QDPRTGSSKI FPGNWDNHSH KKNLFETPIL ARYVRILPVA WHNRIALRLE LLGC. It is sometimes possible for the material contained within the vial of "MFG-E8, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.