Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA114938_SDS_PAGE15.jpg SDS-PAGE

72 kDa type IV collagenase Recombinant Protein | Mmp2 recombinant protein

Recombinant Rat 72 kDa type IV collagenase

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
72 kDa type IV collagenase; N/A; Recombinant Rat 72 kDa type IV collagenase; 72 kDa gelatinaseGelatinase A; Matrix metalloproteinase-2; MMP-2; Mmp2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
110-662. Full Length of Mature Protein
Sequence
YNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNGDGQPCKFPFRFQGTSYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKVWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSNDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFSGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGCFEQMFTDALGIDEYGG
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA114938_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Mmp2 recombinant protein
Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly-|-Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascular tissues. PEX, the C-terminal non-catalytic fragment of MMP2, posseses anti-angiogenic and anti-tumor properties and inhibits cell migration and cell adhesion to FGF2 and vitronectin. Ligand for integrin alpha-v/beta3 on the surface of blood vessels.
References
Homology cloning of rat 72 kDa type IV collagenase cytokine and second-messenger inducibility in glomerular mesangial cells.Marti H.P., McNeil L., Davies M., Martin J., Lovett D.H.Biochem. J. 291:441-446(1993) The cloning of the cDNA encoding rat gelatinase A from a rat skin wound cDNA library.Okada A., Basset P.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64.1 kDa
NCBI Official Full Name
72 kDa type IV collagenase
NCBI Official Synonym Full Names
matrix metallopeptidase 2
NCBI Official Symbol
Mmp2
UniProt Protein Name
72 kDa type IV collagenase
UniProt Gene Name
Mmp2
UniProt Synonym Gene Names
MMP-2
UniProt Entry Name
MMP2_RAT

Similar Products

Product Notes

The Mmp2 mmp2 (Catalog #AAA114938) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 110-662. Full Length of Mature Protein. The amino acid sequence is listed below: YNFFPRKPKW DKNQITYRII GYTPDLDPET VDDAFARALK VWSDVTPLRF SRIHDGEADI MINFGRWEHG DGYPFDGKDG LLAHAFAPGT GVGGDSHFDD DELWTLGEGQ VVRVKYGNAD GEYCKFPFLF NGREYSSCTD TGRSDGFLWC STTYNFEKDG KYGFCPHEAL FTMGGNGDGQ PCKFPFRFQG TSYNSCTTEG RTDGYRWCGT TEDYDRDKKY GFCPETAMST VGGNSEGAPC VFPFTFLGNK YESCTSAGRS DGKVWCATTT NYDDDRKWGF CPDQGYSLFL VAAHEFGHAM GLEHSQDPGA LMAPIYTYTK NFRLSNDDIK GIQELYGPSP DADTDTGTGP TPTLGPVTPE ICKQDIVFDG IAQIRGEIFF FKDRFIWRTV TPRDKPTGPL LVATFWPELP EKIDAVYEAP QEEKAVFFAG NEYWVYSAST LERGYPKPLT SLGLPPDVQQ VDAAFNWSKN KKTYIFSGDK FWRYNEVKKK MDPGFPKLIA DSWNAIPDNL DAVVDLQGGG HSYFFKGAYY LKLENQSLKS VKFGSIKSDW LGCFEQMFTD ALGIDEYGG. It is sometimes possible for the material contained within the vial of "72 kDa type IV collagenase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.