Application Data
(Recombinant Human MMP-7 cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2 (RD#ES001). The specific activity is >812 pmol/min/ug, as measured under the described conditions.)
MMP-7 Recombinant Protein | MMP7 recombinant protein
Recombinant Human MMP-7 Protein
Purity
>90% by SDS-PAGE.
Synonyms
MMP-7; N/A; Recombinant Human MMP-7 Protein; MMP7, MPSL1, PUMP1, Matrilysin, 3.4.24.23, Matrin, Matrix metalloproteinase-7, MMP-7, Pump-1 protease, Uterine metalloproteinase; MMP7 recombinant protein
Host
CHO Cells
Purity/Purification
>90% by SDS-PAGE.
Form/Format
Lyophilized from 0.22 um filtered solution in 10mM HEPES, 5mM CaCl2, 150mM NaCl (pH7.5). Normally 8% trehalose is added as protectant before lyophilization.
Sequence
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
Species
Human
Tag
C-His
Endotoxin
<0.01EU/ug of the protein by LAL method
Bio-Activity
Measured by its ability to cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2 (RD #ES001). The specific activity is >812 pmol/min/ug, as measured under the described conditions.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
Application Data
(Recombinant Human MMP-7 cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2 (RD#ES001). The specific activity is >812 pmol/min/ug, as measured under the described conditions.)
Application Data
(Recombinant Human MMP-7 cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2 (RD#ES001). The specific activity is >812 pmol/min/ug, as measured under the described conditions.)
SDS-PAGE
(Recombinant Human MMP-7 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 30-40 kDa.)
SDS-PAGE
(Recombinant Human MMP-7 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 30-40 kDa.)
Related Product Information for MMP7 recombinant protein
MMP-7, Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.Matrix metalloproteinases (MMPs) are a family of zinc and calcium dependent endopeptidases with the combined ability to degrade all the components of the extracellular matrix. MMP-7 (matrilysin) is expressed in epithelial cells of normal and diseased tissues, and is capable of digesting a large series of proteins of the extracellular matrix including collagen IV and X, gelatin, casein, laminin, aggrecan, entactin, elastin and versican. MMP-7 is implicated in the activation of other proteinases such as plasminogen, MMP-1, MMP-2, and MMP-9. In addition to its roles in connective tissue remodeling and cancer, MMP-7 also regulates intestinal alpha ?defensin activation in innate host defense, releases tumor necrosis factor-alpha in a model of herniated disc resorption, and cleaves FasL to generate a soluble form in a model of prostate involution. Structurally, MMP-7 is the smallest of the MMPs and consists of two domains: a pro-domain that is cleaved upon activation and a catalytic domain containing the zinc-binding site.
Product Categories/Family for MMP7 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Protein Name
Matrilysin
UniProt Gene Name
MMP7
UniProt Synonym Gene Names
MPSL1; PUMP1; MMP-7
UniProt Entry Name
MMP7_HUMAN
Similar Products
Product Notes
The MMP7 mmp7 (Catalog #AAA283372) is a Recombinant Protein produced from CHO Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MRLTVLCAVC LLPGSLALPL PQEAGGMSEL QWEQAQDYLK RFYLYDSETK NANSLEAKLK EMQKFFGLPI TGMLNSRVIE IMQKPRCGVP DVAEYSLFPN SPKWTSKVVT YRIVSYTRDL PHITVDRLVS KALNMWGKEI PLHFRKVVWG TADIMIGFAR GAHGDSYPFD GPGNTLAHAF APGTGLGGDA HFDEDERWTD GSSLGINFLY AATHELGHSL GMGHSSDPNA VMYPTYGNGD PQNFKLSQDD IKGIQKLYGK RSNSRKK. It is sometimes possible for the material contained within the vial of "MMP-7, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.