MMP9 recombinant protein
Recombinant Human MMP9 Protein
Gene Names
MMP9; GELB; CLG4B; MMP-9; MANDP2
Applications
SDS-Page, ELISA, Western Blot
Purity
> 95% as determined by SDS-PAGE
Synonyms
MMP9; N/A; Recombinant Human MMP9 Protein; GELB; Gelatinase B; CLG4B; CLG4-B; 92 KDa Gelatinase; 92kDa Type IV Collagenase; MMP9 recombinant protein
Host
E. coli AA 210-346 (P14780).
Purity/Purification
> 95% as determined by SDS-PAGE
Form/Format
58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0,with 15% glycerol.
Concentration
1 mg/mL (varies by lot)
Sequence
WSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTAN
YDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYR
WCATTANYDRDKLFGFCPTRADSTVMGGNSAGEL
Sequence Length
707
Applicable Applications for MMP9 recombinant protein
SDS-PAGE, ELISA, WB (Western Blot)
Source
Human
Species
Human
Protein Residues
with N-terminal 6×His-tag.
Predicted Molecular Mass
Predicted MW: 21 kDa
Observed MW: 21 kDa
Observed MW: 21 kDa
USAGE
MMP9 Protein-Centrifuge the standard vial at 6000-10000rpm for 30s.
Preparation and Storage
Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage.
Stability: The recombinant protein is stable for up to 6 months from date of receipt at -80°C.
Stability: The recombinant protein is stable for up to 6 months from date of receipt at -80°C.
Related Product Information for MMP9 recombinant protein
MMP-9 (also known as gelatinase B) is secreted as a 92 kDa zymogen. Cleavage of pro-MMP-9 at or near residue 87 results in the active enzyme with a mass of approximately 82 kDa. MMP-9 has three fibronectin type II domains, a hemopexin-like domain and a proline-rich type V collagen-homologous domain. Pro-MMP-9 can be activated by MMP-3 or by certain bacterial proteinases. MMP-9 is inhibited by?2-macroglobulin or by TIMP-1, which binds to pro-MMP-9 as well as to active MMP-9.Pro-MMP-9 is secreted by monocytes, macrophages, neutrophils, keratinocytes, fibroblasts, osteoclasts, chondrocytes, skeletal muscle satellite cells, endothelial cells, and various tumor cells. Pro-MMP-9 expression is upregulated by TGF-?1, IL-1?, TGF-?, PDGF-AB.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21kDa
NCBI Official Full Name
matrix metalloproteinase-9 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 9
NCBI Official Symbol
MMP9
NCBI Official Synonym Symbols
GELB; CLG4B; MMP-9; MANDP2
NCBI Protein Information
matrix metalloproteinase-9
UniProt Protein Name
Matrix metalloproteinase-9
UniProt Gene Name
MMP9
UniProt Synonym Gene Names
CLG4B; MMP-9; GELB
UniProt Entry Name
MMP9_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The MMP9 mmp9 (Catalog #AAA55970) is a Recombinant Protein produced from E. coli AA 210-346 (P14780). and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MMP9 can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the MMP9 mmp9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: WSLGKGVVVP TRFGNADGAA CHFPFIFEGR SYSACTTDGR SDGLPWCSTT AN YDTDDRF GFCPSERLYT RDGNADGKPC QFPFIFQGQS YSACTTDGRS DGYR WCATT ANYDRDKLFG FCPTRADSTV MGGNSAGEL. It is sometimes possible for the material contained within the vial of "MMP9, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
