Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA115315_SDS_PAGE15.jpg SDS-PAGE

Matrix metalloproteinase-9 Recombinant Protein | MMP9 recombinant protein

Recombinant Canis familiaris Matrix metalloproteinase-9

Average rating 0.0
No ratings yet
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Matrix metalloproteinase-9; N/A; Recombinant Canis familiaris Matrix metalloproteinase-9; 92 kDa gelatinase; 92 kDa type IV collagenase; Gelatinase B; GELB; MMP9 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
107-704
Sequence
FQTFEGDLKWHHNDITYWIQNYSEDLPRDVIDDAFARAFAVWSAVTPLTFTRVYGPEADIIIQFGVREHGDGYPFDGKNGLLAHAFPPGPGIQGDAHFDDEELWTLGKGVVVPTHFGNADGAPCHFPFTFEGRSYSACTTDGRSDDTPWCSTTADYDTDRRFGFCPSEKLYAQDGNGDGKPCVFPFTFEGRSYSTCTTDGRSDGYRWCSTTADYDQDKLYGFCPTRVDSAVTGGNSAGEPCVFPFIFLGKQYSTC
Sequence Length
704
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA115315_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for MMP9 recombinant protein
Could play a role in bone osteoclastic resorption. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments.
References
Dog mast cell alpha-chymase activates progelatinase B by cleaving the Phe88-Gln89 and Phe91-Glu92 bonds of the catalytic domain.Fang K.C., Raymond W.W., Blount J.L., Caughey G.H.J. Biol. Chem. 272:25628-25635(1997) High expression of 92 kDa type IV collagenase (matrix metalloproteinase-9) in canine mammary adenocarcinoma.Yokota H., Kumata T., Taketaba S., Kobayashi T., Moue H., Taniyama H., Hirayama K., Kagawa Y., Itoh N., Fujita O., Nakade T., Yuasa A.Biochim. Biophys. Acta 1568:7-12(2001)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
68.3 kDa
NCBI Official Full Name
Matrix metalloproteinase-9
NCBI Official Symbol
MMP9
NCBI Protein Information
matrix metalloproteinase-9
UniProt Protein Name
Matrix metalloproteinase-9
UniProt Gene Name
MMP9
UniProt Synonym Gene Names
MMP-9; GELB
UniProt Entry Name
MMP9_CANLF

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MMP9 mmp9 (Catalog #AAA115315) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 107-704. The amino acid sequence is listed below: FQTFEGDLKW HHNDITYWIQ NYSEDLPRDV IDDAFARAFA VWSAVTPLTF TRVYGPEADI IIQFGVREHG DGYPFDGKNG LLAHAFPPGP GIQGDAHFDD EELWTLGKGV VVPTHFGNAD GAPCHFPFTF EGRSYSACTT DGRSDDTPWC STTADYDTDR RFGFCPSEKL YAQDGNGDGK PCVFPFTFEG RSYSTCTTDG RSDGYRWCST TADYDQDKLY GFCPTRVDSA VTGGNSAGEP CVFPFIFLGK QYSTC. It is sometimes possible for the material contained within the vial of "Matrix metalloproteinase-9, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.