Metalloproteinase-disintegrin-like mocarhagin Recombinant Protein | MOC recombinant protein
Recombinant Naja mossambica (Mozambique spitting cobra) Snake venom metalloproteinase-disintegrin-like mocarhagin
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Metalloproteinase-disintegrin-like mocarhagin; N/A; Recombinant Naja mossambica (Mozambique spitting cobra) Snake venom metalloproteinase-disintegrin-like mocarhagin; Zinc metalloproteinase mocarhagin; MOC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
192-609aa; Full Length
Sequence
TNTPEQDRYLQAKKYIEFYVVVDNVMYRKYTGKLHVITRRVYEMVNALNTMYRRLNFHIALIGLEIWSNGNEINVQSDVQATLDLFGEWRENKLLPRKRNDNAQLLTSTEFNGTTTGLGYIGSLCSPKKSVAVVQDHSKSTSMVAITMAHQMGHNLGMNDDRASCTCGSNKCIMSTKYYESLSEFSSCSVQEHREYLLRDRPQCILNKPSRKAIVTPPVCGNYFVERGEECDCGSPEDCQNTCCDAATCKLQHEAQCDSGECCEKCKFKGAGAECRAAKNDCDFPELCTGRSAKCPKDSFQRNGHPCQNNQGYCYNGTCPTLTNQCATLWGPGAKMSPGLCFMLNWNARSCGLCRKENGRKILCAAKDVKCGRLFCKKKNSMICHCPPPSKDPNYGMVAPGTKCGVKKVCRNRQCVKV
Sequence Length
609
Species
Naja mossambica (Mozambique spitting cobra)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for MOC recombinant protein
Snake venom zinc metalloproteinase that inhibits platelet aggregation by cleaving platelet glycoprotein Ib alpha (GP1BA) at Glu-298/Asp-299, and abolishes binding of von Willebrand factor (VWF) to GPIBA. Cleaves P-selectin glycoprotein ligand-1 (PSGL-1/SELPLG) at Tyr-51/Asp-52, and completely abolishes the binding of PSGL-1 to P-selectin. Anionic amino acid sequences containing sulfated tyrosines are needed for cleavages. Inhibits the thrombin-induced platelet aggregation, and the thrombin-induced release of ATP and ADP. Has lectin activity
References
"Molecular characterization of mocarhagins: a multi-gene family of metalloproteinases expressed in cobra venom." Sako D., Shaw G.D. Submitted (MAY-2002)
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
50.7 kDa
NCBI Official Full Name
Snake venom metalloproteinase-disintegrin-like mocarhagin
UniProt Protein Name
Snake venom metalloproteinase-disintegrin-like mocarhagin
UniProt Gene Name
MOC
UniProt Synonym Gene Names
Mocarhagin-1; SVMP
UniProt Entry Name
VM3M1_NAJMO
Similar Products
Product Notes
The Metalloproteinase-disintegrin-like mocarhagin moc (Catalog #AAA117428) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 192-609aa; Full Length. The amino acid sequence is listed below: TNTPEQDRYL QAKKYIEFYV VVDNVMYRKY TGKLHVITRR VYEMVNALNT MYRRLNFHIA LIGLEIWSNG NEINVQSDVQ ATLDLFGEWR ENKLLPRKRN DNAQLLTSTE FNGTTTGLGY IGSLCSPKKS VAVVQDHSKS TSMVAITMAH QMGHNLGMND DRASCTCGSN KCIMSTKYYE SLSEFSSCSV QEHREYLLRD RPQCILNKPS RKAIVTPPVC GNYFVERGEE CDCGSPEDCQ NTCCDAATCK LQHEAQCDSG ECCEKCKFKG AGAECRAAKN DCDFPELCTG RSAKCPKDSF QRNGHPCQNN QGYCYNGTCP TLTNQCATLW GPGAKMSPGL CFMLNWNARS CGLCRKENGR KILCAAKDVK CGRLFCKKKN SMICHCPPPS KDPNYGMVAP GTKCGVKKVC RNRQCVKV. It is sometimes possible for the material contained within the vial of "Metalloproteinase-disintegrin-like mocarhagin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
