Myelin Oligodendrocyte Glycoprotein Recombinant Protein | MOG recombinant protein
Recombinant Human Myelin Oligodendrocyte Glycoprotein
Gene Names
MOG; BTN6; BTNL11; MOGIG2; NRCLP7
Purity
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
Myelin Oligodendrocyte Glycoprotein; N/A; Recombinant Human Myelin Oligodendrocyte Glycoprotein; MOG Human; Myelin Oligodendrocyte Glycoprotein Human Recombinant; MOG; MOGIG-2; MGC26137; MOG recombinant protein
Host
E Coli
Purity/Purification
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
The Myelin Oligodendrocyte Glycoprotein 0.5mg/ml solution was lyophilized from 20mM sodium acetate buffer pH-4 and 0.3M sodium chloride.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH
Sequence Length
224
Solubility
It is recommended to reconstitute the lyophilized MOG in sterile 10mM Acetic acid not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Preparation and Storage
Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution MOG should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for MOG recombinant protein
Description: Myelin Oligodendrocyte Glycoprotein produced in E Coli is a single, non-glycosylated polypeptide chain containing a total of 132 amino acids (Met + 30-154 a.a. + 6x His tag at C-terminus) and having a total molecular mass of 15.2 kDa.
Introduction: Myelin Oligodendrocyte Glycoprotein is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a prime target antigen that plays a role in immune-mediated demyelination. Myelin Oligodendrocyte Glycoprotein is involved in completion and maintenance of the myelin sheath and in cell-cell communication. MOG protein was found to differentially expressed in the dorsolateral prefrontal cortex and in the temporal lobe from patients with schizophrenia. MOG-specific antibody is crucial to the initiation of MOG-induced murine experimental autoimmune encephalomyelitis.
Introduction: Myelin Oligodendrocyte Glycoprotein is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a prime target antigen that plays a role in immune-mediated demyelination. Myelin Oligodendrocyte Glycoprotein is involved in completion and maintenance of the myelin sheath and in cell-cell communication. MOG protein was found to differentially expressed in the dorsolateral prefrontal cortex and in the temporal lobe from patients with schizophrenia. MOG-specific antibody is crucial to the initiation of MOG-induced murine experimental autoimmune encephalomyelitis.
Product Categories/Family for MOG recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,528 Da
NCBI Official Full Name
myelin-oligodendrocyte glycoprotein isoform alpha3
NCBI Official Synonym Full Names
myelin oligodendrocyte glycoprotein
NCBI Official Symbol
MOG
NCBI Official Synonym Symbols
BTN6; BTNL11; MOGIG2; NRCLP7
NCBI Protein Information
myelin-oligodendrocyte glycoprotein; MOG Ig-AluB; MOG alpha-5
UniProt Protein Name
Myelin-oligodendrocyte glycoprotein
UniProt Gene Name
MOG
UniProt Entry Name
MOG_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The MOG mog (Catalog #AAA38579) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MGQFRVIGPR HPIRALVGDE VELPCRISPG KNATGMEVGW YRPPFSRVVH LYRNGKDQDG DQAPEYRGRT ELLKDAIGEG KVTLRIRNVR FSDEGGFTCF FRDHSYQEEA AMELKVEDPF YWVSPGHHHH HH. It is sometimes possible for the material contained within the vial of "Myelin Oligodendrocyte Glycoprotein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.