Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25596_WB6.jpg WB (Western Blot) (ACSL5 monoclonal antibody, Western Blot analysis of ACSL5 expression in HepG2.)

Mouse anti-Human ACSL5 Monoclonal Antibody | anti-ACSL5 antibody

ACSL5 (Long-chain-fatty-acid-CoA Ligase 5, Long-chain acyl-CoA Synthetase 5, LACS 5, ACS5, FACL5, UNQ633/PRO1250) (PE)

Average rating 0.0
No ratings yet
Gene Names
ACSL5; ACS2; ACS5; FACL5
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ACSL5, Antibody; ACSL5 (Long-chain-fatty-acid-CoA Ligase 5, Long-chain acyl-CoA Synthetase 5, LACS 5, ACS5, FACL5, UNQ633/PRO1250) (PE); anti-ACSL5 antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5H8
Specificity
Recognizes human ACSL5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
739
Applicable Applications for anti-ACSL5 antibody
ELISA, IHC (Immunohistochemistry), IP (Immunoprecipitation), WB (Western Blot)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa91-187, from human ACSL5 (NP_057318, 51703) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(ACSL5 monoclonal antibody, Western Blot analysis of ACSL5 expression in HepG2.)

product-image-AAA25596_WB6.jpg WB (Western Blot) (ACSL5 monoclonal antibody, Western Blot analysis of ACSL5 expression in HepG2.)

Application Data

(Detection limit for recombinant GST tagged ACSL5 is ~0.1ng/ml as a capture antibody.)

product-image-AAA25596_APP5.jpg Application Data (Detection limit for recombinant GST tagged ACSL5 is ~0.1ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of ACSL5 transfected lysate using ACSL5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ACSL5 rabbit polyclonal antibody.)

product-image-AAA25596_IP4.jpg IP (Immunoprecipitation) (Immunoprecipitation of ACSL5 transfected lysate using ACSL5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ACSL5 rabbit polyclonal antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to ACSL5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

product-image-AAA25596_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to ACSL5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western Blot analysis of ACSL5 expression in transfected 293T cell line by ACSL5 monoclonal antibody. Lane 1: ACSL5 transfected lysate (82.3kD). Lane 2: Non-transfected lysate.)

product-image-AAA25596_WB2.jpg WB (Western Blot) (Western Blot analysis of ACSL5 expression in transfected 293T cell line by ACSL5 monoclonal antibody. Lane 1: ACSL5 transfected lysate (82.3kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.67kD).)

product-image-AAA25596_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (36.67kD).)
Product Categories/Family for anti-ACSL5 antibody
References
1. Tripodi D, Quemener S, Renaudin K, Ferron C, Malard O, Guisle-Marsollier I, Sebille-Rivain V, Verger C, Geraut C, Gratas-Rabbia-Re C.BMC Med Genomics. 2009 Nov 10;2:652. 2. Mashima T, Sato S, Sugimoto Y, Tsuruo T, Seimiya H.Oncogene. 2009 Jan 8;28(1):9-19. Epub 2008 Sep 22.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
long-chain-fatty-acid--CoA ligase 5 isoform a
NCBI Official Synonym Full Names
acyl-CoA synthetase long chain family member 5
NCBI Official Symbol
ACSL5
NCBI Official Synonym Symbols
ACS2; ACS5; FACL5
NCBI Protein Information
long-chain-fatty-acid--CoA ligase 5
UniProt Protein Name
Long-chain-fatty-acid--CoA ligase 5
UniProt Gene Name
ACSL5
UniProt Synonym Gene Names
ACS5; FACL5; LACS 5
UniProt Entry Name
ACSL5_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ACSL5 acsl5 (Catalog #AAA25596) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ACSL5 (Long-chain-fatty-acid-CoA Ligase 5, Long-chain acyl-CoA Synthetase 5, LACS 5, ACS5, FACL5, UNQ633/PRO1250) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACSL5 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), IP (Immunoprecipitation), WB (Western Blot). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACSL5 acsl5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACSL5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.