Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24417_WB7.jpg WB (Western Blot) (ACTN4 monoclonal antibody Western Blot analysis of ACTN4 expression in HeLa NE.)

Mouse ACTN4 Monoclonal Antibody | anti-ACTN4 antibody

ACTN4 (Alpha-actinin-4, Non-muscle alpha-actinin 4, F-actin Cross-linking Protein) APC

Gene Names
ACTN4; FSGS; FSGS1; ACTININ-4
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ACTN4, Antibody; ACTN4 (Alpha-actinin-4, Non-muscle alpha-actinin 4, F-actin Cross-linking Protein) APC; anti-ACTN4 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D10
Specificity
Recognizes human ACTN4. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ACTN4 antibody
ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IF: 20ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa592-701 from human ACTN4 (NP_004915) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(ACTN4 monoclonal antibody Western Blot analysis of ACTN4 expression in HeLa NE.)

product-image-AAA24417_WB7.jpg WB (Western Blot) (ACTN4 monoclonal antibody Western Blot analysis of ACTN4 expression in HeLa NE.)

WB (Western Blot)

(ACTN4 monoclonal antibody Western Blot analysis of ACTN4 expression in NIH/3T3.)

product-image-AAA24417_WB6.jpg WB (Western Blot) (ACTN4 monoclonal antibody Western Blot analysis of ACTN4 expression in NIH/3T3.)

Application Data

(Detection limit for recombinant GST tagged ACTN4 is ~0.1ng/ml as a capture antibody.)

product-image-AAA24417_APP5.jpg Application Data (Detection limit for recombinant GST tagged ACTN4 is ~0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to ACTN4 on HeLa cell. [antibody concentration 20ug/ml].)

product-image-AAA24417_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to ACTN4 on HeLa cell. [antibody concentration 20ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to ACTN4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

product-image-AAA24417_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to ACTN4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western Blot analysis of ACTN4 expression in transfected 293T cell line by ACTN4 monoclonal antibody. Lane 1: ACTN4 transfected lysate (104.9kD). Lane 2: Non-transfected lysate.)

product-image-AAA24417_WB2.jpg WB (Western Blot) (Western Blot analysis of ACTN4 expression in transfected 293T cell line by ACTN4 monoclonal antibody. Lane 1: ACTN4 transfected lysate (104.9kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(ACTN4 monoclonal antibody Western Blot analysis of ACTN4 expression in PC-12.)

product-image-AAA24417_WB.jpg WB (Western Blot) (ACTN4 monoclonal antibody Western Blot analysis of ACTN4 expression in PC-12.)
Product Categories/Family for anti-ACTN4 antibody
References
1. RNAi-mediated down-regulation of alpha-actinin-4 decreases invasion potential in oral squamous cell carcinoma. Yamada S, Yanamoto S, Yoshida H, Yoshitomi I, Kawasaki G, Mizuno A, Nemoto TK.Int J Oral Maxillofac Surg. 2009 Nov 11.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
81
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,579 Da
NCBI Official Full Name
alpha-actinin-4 isoform 1
NCBI Official Synonym Full Names
actinin alpha 4
NCBI Official Symbol
ACTN4
NCBI Official Synonym Symbols
FSGS; FSGS1; ACTININ-4
NCBI Protein Information
alpha-actinin-4
UniProt Protein Name
Alpha-actinin-4
UniProt Gene Name
ACTN4
UniProt Entry Name
ACTN4_HUMAN

Similar Products

Product Notes

The ACTN4 actn4 (Catalog #AAA24417) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ACTN4 (Alpha-actinin-4, Non-muscle alpha-actinin 4, F-actin Cross-linking Protein) APC reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ACTN4 can be used in a range of immunoassay formats including, but not limited to, ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). IF: 20ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACTN4 actn4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACTN4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.