Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA125931_FCM13.png FCM/FACS (Flow Cytometry) (Figure 2. Flow Cytometry analysis of 293T cells using anti-AFF4 antibody (AAA125931).Overlay histogram showing 293T cells stained with AAA125931 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti- AFF4 Antibody (AAA125931, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Mouse anti-Human AFF4 Monoclonal Antibody | anti-AFF4 antibody

Anti-AFF4 Antibody (monoclonal, 8G12)

Gene Names
AFF4; MCEF; AF5Q31
Reactivity
Human
Applications
Flow Cytometry, Functional Assay, Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
AFF4, Antibody; Anti-AFF4 Antibody (monoclonal, 8G12); AFF4; AF5Q31; MCEF; HSPC092; AF4/FMR2 family member 4; ALL1-fused gene from chromosome 5q31 protein; Protein AF-5q31; Major CDK9 elongation factor-associated protein
; anti-AFF4 antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
Mouse IgG2b
Clone Number
8G12
Specificity
Mouse IgG monoclonal antibody for AFF4 detection.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized. Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Applicable Applications for anti-AFF4 antibody
FCM/FACS (Flow Cytometry), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human AFF4(6-53aa RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ), identical to the related mouse sequence.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Recommended Detection Systems
Recommended Detection Systems
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 2. Flow Cytometry analysis of 293T cells using anti-AFF4 antibody (AAA125931).Overlay histogram showing 293T cells stained with AAA125931 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti- AFF4 Antibody (AAA125931, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA125931_FCM13.png FCM/FACS (Flow Cytometry) (Figure 2. Flow Cytometry analysis of 293T cells using anti-AFF4 antibody (AAA125931).Overlay histogram showing 293T cells stained with AAA125931 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti- AFF4 Antibody (AAA125931, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

WB (Western Blot)

(Figure 1. Western blot analysis of AFF4 using anti-AFF4 antibody (AAA125931).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human HELA whole cell lysatesLane 2: human HEPG2 whole cell lysatesLane 3: human CACO-2 whole cell lysatesLane 4: human HEK293 whole cell lysatesLane 5: human MDA-MB-453 whole cell lysatesLane 6: human PANC-1 whole cell lysatesLane 7: human SW620 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with mouse anti- AFF4 antigen affinity purified monoclonal antibody (Catalog # AAA125931) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for AFF4 at approximately 150KD. The expected band size for AFF4 is at 150KD.)

product-image-AAA125931_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of AFF4 using anti-AFF4 antibody (AAA125931).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human HELA whole cell lysatesLane 2: human HEPG2 whole cell lysatesLane 3: human CACO-2 whole cell lysatesLane 4: human HEK293 whole cell lysatesLane 5: human MDA-MB-453 whole cell lysatesLane 6: human PANC-1 whole cell lysatesLane 7: human SW620 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with mouse anti- AFF4 antigen affinity purified monoclonal antibody (Catalog # AAA125931) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for AFF4 at approximately 150KD. The expected band size for AFF4 is at 150KD.)
Related Product Information for anti-AFF4 antibody
The AFF4 gene encodes a scaffold protein that functions as a core component of the super elongation complex (SEC), which is involved in transcriptional regulation during embryogenesis. The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. This gene is mapped to chromosome 5q31.
References
1. Izumi, K., Nakato, R., Zhang, Z., Edmondson, A. C., Noon, S., Dulik, M. C., Rajagopalan, R., Venditti, C. P., Gripp, K., Samanich, J., Zackai, E. H., Deardorff, M. A., and 10 others. Germline gain-of-function mutations in AFF4 cause a developmental syndrome functionally linking the super elongation complex and cohesin. Nature Genet. 47: 338-344, 2015.
2. Taki, T., Kano, H., Taniwaki, M., Sako, M., Yanagisawa, M., Hayashi, Y. AF5q31, a newly identified AF4-related gene, is fused to MLL in infant acute lymphoblastic leukemia with ins(5;11)(q31;q31q23). Proc. Nat. Acad. Sci. 96: 14535-14540, 1999.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
1163
NCBI Official Full Name
AF4/FMR2 family member 4
NCBI Official Synonym Full Names
AF4/FMR2 family, member 4
NCBI Official Symbol
AFF4
NCBI Official Synonym Symbols
MCEF; AF5Q31
NCBI Protein Information
AF4/FMR2 family member 4; ALL1-fused gene from chromosome 5q31 protein; major CDK9 elongation factor-associated protein
UniProt Protein Name
AF4/FMR2 family member 4
UniProt Gene Name
AFF4
UniProt Synonym Gene Names
AF5Q31; MCEF; Protein AF-5q31
UniProt Entry Name
AFF4_HUMAN

Similar Products

Product Notes

The AFF4 aff4 (Catalog #AAA125931) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-AFF4 Antibody (monoclonal, 8G12) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AFF4 can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the AFF4 aff4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AFF4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.