Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA28601_ICC11.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Rat brain tissue using Alpha-synuclein Mouse mAb (AAA28601, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Mouse IgG (H+L) (AS008, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

Mouse anti-Human Alpha-synuclein Monoclonal Antibody | anti-SNCA antibody

Alpha-synuclein Mouse mAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, ELISA
Purity
Affinity purification
Synonyms
Alpha-synuclein, Antibody; Alpha-synuclein Mouse mAb; PD1; NACP; PARK1; PARK4; anti-SNCA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Applicable Applications for anti-SNCA antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), ELISA (EIA)
Application Notes
WB: 1:2500-1:10000
IHC-P: 1:1000-1:4000
IF/ICC: 1:200-1:800
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human Alpha-synuclein(NP_000336.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Rat brain tissue using Alpha-synuclein Mouse mAb (AAA28601, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Mouse IgG (H+L) (AS008, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

product-image-AAA28601_ICC11.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Rat brain tissue using Alpha-synuclein Mouse mAb (AAA28601, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Mouse IgG (H+L) (AS008, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Mouse brain tissue using Alpha-synuclein Mouse mAb (AAA28601, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

product-image-AAA28601_ICC10.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Mouse brain tissue using Alpha-synuclein Mouse mAb (AAA28601, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Human brain tissue using Alpha-synuclein Mouse mAb (AAA28601, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Mouse IgG (H+L) (AS008, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

product-image-AAA28601_ICC9.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Human brain tissue using Alpha-synuclein Mouse mAb (AAA28601, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Mouse IgG (H+L) (AS008, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

ICC (Immunocytochemistry)

(Confocal imaging of HEL cells using Alpha-synuclein Mouse mAb (AAA28601, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Mouse IgG (H+L) (AS008, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.)

product-image-AAA28601_ICC8.jpg ICC (Immunocytochemistry) (Confocal imaging of HEL cells using Alpha-synuclein Mouse mAb (AAA28601, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Mouse IgG (H+L) (AS008, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Alpha-synuclein Mouse mAb (AAA28601) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.)

product-image-AAA28601_IHC7.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Alpha-synuclein Mouse mAb (AAA28601) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Alpha-synuclein Mouse mAb (AAA28601) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.)

product-image-AAA28601_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Alpha-synuclein Mouse mAb (AAA28601) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using Alpha-synuclein Mouse mAb (AAA28601) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.)

product-image-AAA28601_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using Alpha-synuclein Mouse mAb (AAA28601) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Alpha-synuclein Mouse mAb (AAA28601) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.)

product-image-AAA28601_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Alpha-synuclein Mouse mAb (AAA28601) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using Alpha-synuclein Mouse mAb (AAA28601) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.)

product-image-AAA28601_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using Alpha-synuclein Mouse mAb (AAA28601) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human brain tissue using Alpha-synuclein Mouse mAb (AAA28601) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.)

product-image-AAA28601_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human brain tissue using Alpha-synuclein Mouse mAb (AAA28601) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using Alpha-synuclein Mouse mAb (AAA28601) at 1:5000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA28601_WB.jpg WB (Western Blot) (Western blot analysis of various lysates using Alpha-synuclein Mouse mAb (AAA28601) at 1:5000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-SNCA antibody
Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 14kDa
Observed MW: 18kDa
UniProt Protein Name
Alpha-synuclein
UniProt Gene Name
SNCA
UniProt Synonym Gene Names
NACP; PARK1; NACP
UniProt Entry Name
SYUA_HUMAN

Similar Products

Product Notes

The SNCA snca (Catalog #AAA28601) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Alpha-synuclein Mouse mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Alpha-synuclein can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), ELISA (EIA). WB: 1:2500-1:10000 IHC-P: 1:1000-1:4000 IF/ICC: 1:200-1:800 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the SNCA snca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDVFMKGLSK AKEGVVAAAE KTKQGVAEAA GKTKEGVLYV GSKTKEGVVH GVATVAEKTK EQVTNVGGAV VTGVTAVAQK TVEGAGSIAA ATGFVKKDQL GKNEEGAPQE GILEDMPVDP DNEAYEMPSE EGYQDYEPEA. It is sometimes possible for the material contained within the vial of "Alpha-synuclein, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.