Application Data
(AMH - staining of ovary tissue from a 25 day old mouse. Formalin fixed paraffin processed tissue)
Mouse AMH Monoclonal Antibody | anti-AMH antibody
MOUSE ANTI HUMAN AMH
Gene Names
AMH; MIF; MIS
Reactivity
Baboon, Mouse, Sheep, Squirrel monkey; NB Antibody activity and working conditions may vary between species
Applications
Western Blot, Immunohistochemistry
Synonyms
AMH, Antibody; MOUSE ANTI HUMAN AMH; MIF; anti-AMH antibody
Host
Mouse
Reactivity
Baboon, Mouse, Sheep, Squirrel monkey; NB Antibody activity and working conditions may vary between species
Clonality
Monoclonal
Isotype
IgG1
Clone Number
5/6
Specificity
AMH
Form/Format
Concentrated Tissue Culture Supernatant - liquid; Con S/N
Sequence Length
560
Applicable Applications for anti-AMH antibody
WB (Western Blot), IHC (Immunohistochemistry)
Perservative Stabilisers
0.1% Sodium Azide
Fusion Partners
Spleen cells from immunised T/O outbred mice were fused with cells of the SP2/0 myeloma line
Immunogen
Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
Target Species
Human
Histology Positive Control Tissue
Ovary
Preparation and Storage
Store at 4 degree C or at -20 degree C if preferred. This product should be stored undiluted. Storage in frost-free freezers is not recommended. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
Shelf Life: 18 months from date of despatch
Shelf Life: 18 months from date of despatch
Application Data
(AMH - staining of ovary tissue from a 25 day old mouse. Formalin fixed paraffin processed tissue)
Application Data
(AMH - staining of ovary tissue from a 25 day old mouse. Formalin fixed paraffin processed tissue)
Related Product Information for anti-AMH antibody
Mouse anti Human AMH, clone 5/6 recognizes human anti-mullerian hormone (AMH), originally classified as a foetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth. AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kDa disulphide linked precursor that is cleaved to release the mature 30kDa homodimer.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
muellerian-inhibiting factor
NCBI Official Synonym Full Names
anti-Mullerian hormone
NCBI Official Symbol
AMH
NCBI Official Synonym Symbols
MIF; MIS
NCBI Protein Information
muellerian-inhibiting factor; Mullerian inhibiting factor; Mullerian inhibiting substance; anti-Muellerian hormone; muellerian-inhibiting substance
UniProt Protein Name
Muellerian-inhibiting factor
UniProt Gene Name
AMH
UniProt Synonym Gene Names
MIF; AMH; MIS
UniProt Entry Name
MIS_HUMAN
Similar Products
Product Notes
The AMH amh (Catalog #AAA49659) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MOUSE ANTI HUMAN AMH reacts with Baboon, Mouse, Sheep, Squirrel monkey; NB Antibody activity and working conditions may vary between species and may cross-react with other species as described in the data sheet. AAA Biotech's AMH can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the AMH amh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AMH, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.