Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25032_WB6.jpg WB (Western Blot) (Western Blot analysis of ATP6V1G2 expression in transfected 293T cell line by ATP6V1G2 monoclonal antibody. Lane 1: ATP6V1G2 transfected lysate (13.6kD). Lane 2: Non-transfected lysate.)

Mouse ATP6V1G2 Monoclonal Antibody | anti-ATP6V1G2 antibody

ATP6V1G2 (V-type Proton ATPase Subunit G 2, V-ATPase Subunit G 2, V-ATPase 13kD Subunit 2, Vacuolar Proton Pump Subunit G 2, ATP6G, ATP6G2, NG38) (FITC)

Average rating 0.0
No ratings yet
Gene Names
ATP6V1G2; NG38; ATP6G; VMA10; ATP6G2
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATP6V1G2, Antibody; ATP6V1G2 (V-type Proton ATPase Subunit G 2, V-ATPase Subunit G 2, V-ATPase 13kD Subunit 2, Vacuolar Proton Pump Subunit G 2, ATP6G, ATP6G2, NG38) (FITC); anti-ATP6V1G2 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2b, lambda
Clone Number
2E11
Specificity
Recognizes human ATP6V1G2. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-ATP6V1G2 antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa41-118 from human ATP6V1G2 (NP_569730) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of ATP6V1G2 expression in transfected 293T cell line by ATP6V1G2 monoclonal antibody. Lane 1: ATP6V1G2 transfected lysate (13.6kD). Lane 2: Non-transfected lysate.)

product-image-AAA25032_WB6.jpg WB (Western Blot) (Western Blot analysis of ATP6V1G2 expression in transfected 293T cell line by ATP6V1G2 monoclonal antibody. Lane 1: ATP6V1G2 transfected lysate (13.6kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(ATP6V1G2 monoclonal antibody Western Blot analysis of ATP6V1G2 expression in NIH/3T3.)

product-image-AAA25032_WB5.jpg WB (Western Blot) (ATP6V1G2 monoclonal antibody Western Blot analysis of ATP6V1G2 expression in NIH/3T3.)

WB (Western Blot)

(ATP6V1G2 monoclonal antibody Western Blot analysis of ATP6V1G2 expression in Raw 264.7.)

product-image-AAA25032_WB4.jpg WB (Western Blot) (ATP6V1G2 monoclonal antibody Western Blot analysis of ATP6V1G2 expression in Raw 264.7.)

WB (Western Blot)

(ATP6V1G2 monoclonal antibody, Western Blot analysis of ATP6V1G2 expression in HepG2.)

product-image-AAA25032_WB3.jpg WB (Western Blot) (ATP6V1G2 monoclonal antibody, Western Blot analysis of ATP6V1G2 expression in HepG2.)

WB (Western Blot)

(ATP6V1G2 monoclonal antibody. Western Blot analysis of ATP6V1G2 expression in PC-12.)

product-image-AAA25032_WB2.jpg WB (Western Blot) (ATP6V1G2 monoclonal antibody. Western Blot analysis of ATP6V1G2 expression in PC-12.)

WB (Western Blot)

(Western Blot detection against Immunogen (34.32kD).)

product-image-AAA25032_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (34.32kD).)
Product Categories/Family for anti-ATP6V1G2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
534
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13kDa
NCBI Official Full Name
V-type proton ATPase subunit G 2 isoform a
NCBI Official Synonym Full Names
ATPase H+ transporting V1 subunit G2
NCBI Official Symbol
ATP6V1G2
NCBI Official Synonym Symbols
NG38; ATP6G; VMA10; ATP6G2
NCBI Protein Information
V-type proton ATPase subunit G 2
UniProt Protein Name
V-type proton ATPase subunit G 2
UniProt Gene Name
ATP6V1G2
UniProt Synonym Gene Names
ATP6G; ATP6G2; NG38
UniProt Entry Name
VATG2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ATP6V1G2 atp6v1g2 (Catalog #AAA25032) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ATP6V1G2 (V-type Proton ATPase Subunit G 2, V-ATPase Subunit G 2, V-ATPase 13kD Subunit 2, Vacuolar Proton Pump Subunit G 2, ATP6G, ATP6G2, NG38) (FITC) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ATP6V1G2 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATP6V1G2 atp6v1g2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP6V1G2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.