Loading...

Skip to main content
WB (Western Blot) (BATF monoclonal antibody Western Blot analysis of BATF expression in Hela NE.)

Mouse BATF Monoclonal Antibody | anti-BATF antibody

BATF (Basic Leucine Zipper Transcriptional Factor ATF-like, B Cell-activating Transcription Factor, SF-HT-activated Gene 2 Protein) (PE)

Gene Names
BATF; SFA2; B-ATF; BATF1; SFA-2
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BATF, Antibody; BATF (Basic Leucine Zipper Transcriptional Factor ATF-like, B Cell-activating Transcription Factor, SF-HT-activated Gene 2 Protein) (PE); anti-BATF antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
8A12
Specificity
Recognizes human BATF. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-BATF antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa34-125 from BATF (NP_006390) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(BATF monoclonal antibody Western Blot analysis of BATF expression in Hela NE.)

WB (Western Blot) (BATF monoclonal antibody Western Blot analysis of BATF expression in Hela NE.)

WB (Western Blot)

(BATF monoclonal antibody Western Blot analysis of BATF expression in PC-12.)

WB (Western Blot) (BATF monoclonal antibody Western Blot analysis of BATF expression in PC-12.)

Application Data

(Detection limit for recombinant GST tagged BATF is ~1ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged BATF is ~1ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of BATF transfected lysate using BATF monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BATF rabbit polyclonal antibody.)

IP (Immunoprecipitation) (Immunoprecipitation of BATF transfected lysate using BATF monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BATF rabbit polyclonal antibody.)

WB (Western Blot)

(Western Blot analysis of BATF expression in transfected 293T cell line by BATF monoclonal antibody Lane 1: BATF transfected lysate (14.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of BATF expression in transfected 293T cell line by BATF monoclonal antibody Lane 1: BATF transfected lysate (14.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(BATF monoclonal antibody Western Blot analysis of BATF expression in NIH/3T3.)

WB (Western Blot) (BATF monoclonal antibody Western Blot analysis of BATF expression in NIH/3T3.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.23kD).)

WB (Western Blot) (Western Blot detection against Immunogen (36.23kD).)
Related Product Information for anti-BATF antibody
The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events.
Product Categories/Family for anti-BATF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14 kDa
NCBI Official Full Name
basic leucine zipper transcriptional factor ATF-like
NCBI Official Synonym Full Names
basic leucine zipper transcription factor, ATF-like
NCBI Official Symbol
BATF
NCBI Official Synonym Symbols
SFA2; B-ATF; BATF1; SFA-2
NCBI Protein Information
basic leucine zipper transcriptional factor ATF-like; SF-HT-activated gene 2 protein; activating transcription factor B; B-cell-activating transcription factor
UniProt Protein Name
Basic leucine zipper transcriptional factor ATF-like
UniProt Gene Name
BATF
UniProt Synonym Gene Names
B-ATF; SFA-2
UniProt Entry Name
BATF_HUMAN

Similar Products

Product Notes

The BATF batf (Catalog #AAA25623) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BATF (Basic Leucine Zipper Transcriptional Factor ATF-like, B Cell-activating Transcription Factor, SF-HT-activated Gene 2 Protein) (PE) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BATF can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BATF batf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BATF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.