Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28539_IP6.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of 293T cells using 3 ug Bax antibody (AAA28539). Western blot was performed from the immunoprecipitate using Bax antibody (AAA28539) at a dilution of 1:500.)

Rabbit anti-Human Bax Monoclonal Antibody | anti-BAX antibody

[KO Validated] Bax Rabbit mAb

Reactivity
Human
Applications
Western Blot, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA
Purity
Affinity purification
Synonyms
Bax, Antibody; [KO Validated] Bax Rabbit mAb; BCL2L4; ax; anti-BAX antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
GGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDEL
Applicable Applications for anti-BAX antibody
WB (Western Blot), IF (Immunofluorescence), ICC (Immunocytochemistry), IP (Immunoprecipitation), ELISA
Application Notes
WB: 1:2000-1:10000
IF/ICC: 1:100-1:2000
IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 10-70 of human Bax (NP_620116.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts of 293T cells using 3 ug Bax antibody (AAA28539). Western blot was performed from the immunoprecipitate using Bax antibody (AAA28539) at a dilution of 1:500.)

product-image-AAA28539_IP6.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of 293T cells using 3 ug Bax antibody (AAA28539). Western blot was performed from the immunoprecipitate using Bax antibody (AAA28539) at a dilution of 1:500.)

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using Bax Rabbit mAb (AAA28539) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA28539_IF5.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using Bax Rabbit mAb (AAA28539) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH-3T3 cells using Bax Rabbit mAb (AAA28539) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA28539_IF4.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH-3T3 cells using Bax Rabbit mAb (AAA28539) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using Bax Rabbit mAb (AAA28539) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA28539_IF3.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using Bax Rabbit mAb (AAA28539) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of lysates from wild type(WT) and Bax knockout (KO) 293T cells, using [KO Validated] Bax Rabbit mAb (AAA28539) at 1:10000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA28539_WB2.jpg WB (Western Blot) (Western blot analysis of lysates from wild type(WT) and Bax knockout (KO) 293T cells, using [KO Validated] Bax Rabbit mAb (AAA28539) at 1:10000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

WB (Western Blot)

(Western blot analysis of various lysates, using [KO Validated] Bax Rabbit mAb (AAA28539) at 1:10000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA28539_WB.jpg WB (Western Blot) (Western blot analysis of various lysates, using [KO Validated] Bax Rabbit mAb (AAA28539) at 1:10000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-BAX antibody
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. The association and the ratio of BAX to BCL2 also determines survival or death of a cell following an apoptotic stimulus. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
581
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 21kDa
Observed MW: 21kDa
UniProt Protein Name
Apoptosis regulator BAX
UniProt Gene Name
BAX
UniProt Synonym Gene Names
BCL2L4; Bcl2-L-4
UniProt Entry Name
BAX_HUMAN

Similar Products

Product Notes

The BAX bax (Catalog #AAA28539) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] Bax Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Bax can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence), ICC (Immunocytochemistry), IP (Immunoprecipitation), ELISA. WB: 1:2000-1:10000 IF/ICC: 1:100-1:2000 IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the BAX bax for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GGGPTSSEQI MKTGALLLQG FIQDRAGRMG GEAPELALDP VPQDASTKKL SECLKRIGDE L. It is sometimes possible for the material contained within the vial of "Bax, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.