Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24149_WB7.jpg WB (Western Blot) (BUB1B monoclonal antibody Western Blot analysis of BUB1B expression in Hela NE.)

Mouse anti-Human BUBR1 Monoclonal Antibody | anti-BUBR1 antibody

BUBR1 (Mitotic Checkpoint Serine/Threonine-protein Kinase BUB1 beta, MAD3/BUB1-related Protein Kinase, hBUBR1, Mitotic Checkpoint Kinase MAD3L, Protein SSK1, BUB1B, MAD3L, SSK1) (AP)

Gene Names
BUB1B; MVA1; SSK1; BUBR1; Bub1A; MAD3L; hBUBR1; BUB1beta
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BUBR1, Antibody; BUBR1 (Mitotic Checkpoint Serine/Threonine-protein Kinase BUB1 beta, MAD3/BUB1-related Protein Kinase, hBUBR1, Mitotic Checkpoint Kinase MAD3L, Protein SSK1, BUB1B, MAD3L, SSK1) (AP); anti-BUBR1 antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G5
Specificity
Recognizes human BUB1B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-BUBR1 antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-130 from human BUB1B (AAH18739) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGR
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(BUB1B monoclonal antibody Western Blot analysis of BUB1B expression in Hela NE.)

product-image-AAA24149_WB7.jpg WB (Western Blot) (BUB1B monoclonal antibody Western Blot analysis of BUB1B expression in Hela NE.)

WB (Western Blot)

(Western Blot detection against Immunogen (39.93kD).)

product-image-AAA24149_WB6.jpg WB (Western Blot) (Western Blot detection against Immunogen (39.93kD).)

Application Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CDC20 and BUB1B. HeLa cells were stained with CDC20 rabbit purified polyclonal 1:1200 and BUB1B mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

product-image-AAA24149_APP5.jpg Application Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CDC20 and BUB1B. HeLa cells were stained with CDC20 rabbit purified polyclonal 1:1200 and BUB1B mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

WB (Western Blot)

(Western blot analysis of BUB1B over-expressed 293 cell line, cotransfected with BUB1B Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with BUB1B monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA24149_WB4.jpg WB (Western Blot) (Western blot analysis of BUB1B over-expressed 293 cell line, cotransfected with BUB1B Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with BUB1B monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged BUB1B is ~0.03ng/ml as a capture antibody.)

product-image-AAA24149_APP3.jpg Application Data (Detection limit for recombinant GST tagged BUB1B is ~0.03ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to BUB1B on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3ug/ml].)

product-image-AAA24149_IHC2.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to BUB1B on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western Blot analysis of BUB1B expression in transfected 293T cell line by BUB1B monoclonal antibody. Lane 1: BUB1B transfected lysate (119.5kD). Lane 2: Non-transfected lysate.)

product-image-AAA24149_WB.jpg WB (Western Blot) (Western Blot analysis of BUB1B expression in transfected 293T cell line by BUB1B monoclonal antibody. Lane 1: BUB1B transfected lysate (119.5kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-BUBR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
701
Molecular Weight
121,386 Da
NCBI Official Full Name
Homo sapiens budding uninhibited by benzimidazoles 1 homolog beta (yeast), mRNA
NCBI Official Synonym Full Names
BUB1 mitotic checkpoint serine/threonine kinase B
NCBI Official Symbol
BUB1B
NCBI Official Synonym Symbols
MVA1; SSK1; BUBR1; Bub1A; MAD3L; hBUBR1; BUB1beta
NCBI Protein Information
mitotic checkpoint serine/threonine-protein kinase BUB1 beta

Similar Products

Product Notes

The BUBR1 (Catalog #AAA24149) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BUBR1 (Mitotic Checkpoint Serine/Threonine-protein Kinase BUB1 beta, MAD3/BUB1-related Protein Kinase, hBUBR1, Mitotic Checkpoint Kinase MAD3L, Protein SSK1, BUB1B, MAD3L, SSK1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BUBR1 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BUBR1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BUBR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.