IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Human liver cancer using C-Reactive Protein (C-Reactive Protein (CRP)) Rabbit mAb (AAA282648) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)
Rabbit anti-Human C-Reactive Protein (CRP) Monoclonal Antibody | anti-CRP antibody
C-Reactive Protein (CRP) Rabbit mAb
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
C-Reactive Protein (CRP), Antibody; C-Reactive Protein (CRP) Rabbit mAb; PTX1; C-Reactive Protein (CRP); anti-CRP antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
VEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP
Applicable Applications for anti-CRP antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Cross Reactivity
Human, Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 125-224 of human C-Reactive Protein (CRP)(P02741).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Human liver cancer using C-Reactive Protein (C-Reactive Protein (CRP)) Rabbit mAb (AAA282648) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)
IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Human liver cancer using C-Reactive Protein (C-Reactive Protein (CRP)) Rabbit mAb (AAA282648) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)
WB (Western Blot)
(Western blot analysis of lysates from Mouse serum, using C-Reactive Protein (CRP) Rabbit mAb (AAA282648) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 3min.)
WB (Western Blot)
(Western blot analysis of lysates from Mouse serum, using C-Reactive Protein (CRP) Rabbit mAb (AAA282648) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 3min.)
WB (Western Blot)
(Western blot analysis of lysates from Human serum, using C-Reactive Protein (CRP) Rabbit mAb (AAA282648) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
WB (Western Blot)
(Western blot analysis of lysates from Human serum, using C-Reactive Protein (CRP) Rabbit mAb (AAA282648) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
Related Product Information for anti-CRP antibody
The protein encoded by this gene belongs to the pentraxin family which also includes serum amyloid P component protein and pentraxin 3. Pentraxins are involved in complement activation and amplification via communication with complement initiation pattern recognition molecules, but also complement regulation via recruitment of complement regulators. The encoded protein has a calcium dependent ligand binding domain with a distinctive flattened beta-jellyroll structure. It exists in two forms as either a pentamer in circulation or as a nonsoluble monomer in tissues. It is involved in several host defense related functions based on its ability to recognize foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli. Elevated expression of the encoded protein is associated with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) infection.
Product Categories/Family for anti-CRP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 23kDa
Observed MW: 25kDa
Observed MW: 25kDa
UniProt Protein Name
C-reactive protein
UniProt Gene Name
CRP
UniProt Synonym Gene Names
PTX1
UniProt Entry Name
CRP_HUMAN
Similar Products
Product Notes
The CRP crp (Catalog #AAA282648) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C-Reactive Protein (CRP) Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C-Reactive Protein (CRP) can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CRP crp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VEFWVDGKPR VRKSLKKGYT VGAEASIILG QEQDSFGGNF EGSQSLVGDI GNVNMWDFVL SPDEINTIYL GGPFSPNVLN WRALKYEVQG EVFTKPQLWP. It is sometimes possible for the material contained within the vial of "C-Reactive Protein (CRP), Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.