Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25631_APP6.jpg Application Data (Detection limit for recombinant GST tagged CAMKK2 is ~1ng/ml as a capture antibody.)

Mouse anti-Human CAMKK2 Monoclonal Antibody | anti-CAMKK2 antibody

CAMKK2 (Calcium/Calmodulin-dependent Protein Kinase Kinase 2, CaM-kinase Kinase 2, CaM-KK 2, CaMKK 2, Calcium/Calmodulin-dependent Protein Kinase Kinase beta, CaM-kinase Kinase beta, CaM-KK beta, CaMKK beta, CAMKKB, KIAA0787) (PE)

Gene Names
CAMKK2; CAMKK; CAMKKB
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CAMKK2, Antibody; CAMKK2 (Calcium/Calmodulin-dependent Protein Kinase Kinase 2, CaM-kinase Kinase 2, CaM-KK 2, CaMKK 2, Calcium/Calmodulin-dependent Protein Kinase Kinase beta, CaM-kinase Kinase beta, CaM-KK beta, CaMKK beta, CAMKKB, KIAA0787) (PE); anti-CAMKK2 antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A11
Specificity
Recognizes human CAMKK2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
2011
Applicable Applications for anti-CAMKK2 antibody
ELISA, IP (Immunoprecipitation), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-130 from CAMKK2 (AAH26060) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSP
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged CAMKK2 is ~1ng/ml as a capture antibody.)

product-image-AAA25631_APP6.jpg Application Data (Detection limit for recombinant GST tagged CAMKK2 is ~1ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of CAMKK2 transfected lysate using CAMKK2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CAMKK2 rabbit polyclonal antibody.)

product-image-AAA25631_IP5.jpg IP (Immunoprecipitation) (Immunoprecipitation of CAMKK2 transfected lysate using CAMKK2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CAMKK2 rabbit polyclonal antibody.)

WB (Western Blot)

(Western Blot analysis of CAMKK2 expression in transfected 293T cell line by CAMKK2 monoclonal antibody Lane 1: CAMKK2 transfected lysate (59.6kD). Lane 2: Non-transfected lysate.)

product-image-AAA25631_WB4.jpg WB (Western Blot) (Western Blot analysis of CAMKK2 expression in transfected 293T cell line by CAMKK2 monoclonal antibody Lane 1: CAMKK2 transfected lysate (59.6kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(CAMKK2 monoclonal antibody Western Blot analysis of CAMKK2 expression in K-562.)

product-image-AAA25631_WB3.jpg WB (Western Blot) (CAMKK2 monoclonal antibody Western Blot analysis of CAMKK2 expression in K-562.)

WB (Western Blot)

(CAMKK2 monoclonal antibody Western Blot analysis of CAMKK2 expression in IMR-32)

product-image-AAA25631_WB2.jpg WB (Western Blot) (CAMKK2 monoclonal antibody Western Blot analysis of CAMKK2 expression in IMR-32)

WB (Western Blot)

(Western Blot detection against Immunogen (40.3kD).)

product-image-AAA25631_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (40.3kD).)
Related Product Information for anti-CAMKK2 antibody
CAMKK2 belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Isoform 1, isoform 2 and isoform 3 phosphorylate CAMK1 and CAMK4. Isoform 3 phosphorylates CAMK1D. Isoform 4, isoform 5 and isoform 6 lacking part of the calmodulin-binding domain are inactive. CAMKK2 appears to be involved in hippocampal activation of CREB1.
Product Categories/Family for anti-CAMKK2 antibody
References
1. A regulatory feedback loop between Ca2+/Calmodulin-dependent protein kinase kinase 2 (CaMKK2) and the androgen receptor in prostate cancer progression. Karacosta LG, Foster BA, Azabdaftari G, Feliciano DM, Edelman AM.J Biol Chem. 2012 Jun 1.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens calcium/calmodulin-dependent protein kinase kinase 2, beta, mRNA
NCBI Official Synonym Full Names
calcium/calmodulin dependent protein kinase kinase 2
NCBI Official Symbol
CAMKK2
NCBI Official Synonym Symbols
CAMKK; CAMKKB
NCBI Protein Information
calcium/calmodulin-dependent protein kinase kinase 2

Similar Products

Product Notes

The CAMKK2 (Catalog #AAA25631) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CAMKK2 (Calcium/Calmodulin-dependent Protein Kinase Kinase 2, CaM-kinase Kinase 2, CaM-KK 2, CaMKK 2, Calcium/Calmodulin-dependent Protein Kinase Kinase beta, CaM-kinase Kinase beta, CaM-KK beta, CaMKK beta, CAMKKB, KIAA0787) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CAMKK2 can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CAMKK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CAMKK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.